Sequence:
download
CE42123sequence.fasta
>RGS-7, isoform f MAGSNSSAMSLDTTDFDFTSTIPSTPSSFDDFFLIPTPAKTSRRRFTVAPSDIIRLKRRLVQHRPNRGPISRTLSYLRSK MDLALSTSSLYPSRDDVRQWEISFESLLNNKFGCALFRQFLKKEFSDENMDFWLECEEFKKMKDGKKSTTQKAIEIYSEF VAEHSPKEVNLDSDTRAATKAAVEAGCKPDTFALAQSRVEQLMSKDSYRRFLRDRLFLDLLESYEITDKEDKPSSSKDKN
view sequence (240 aa)
>RGS-7, isoform f
MAGSNSSAMSLDTTDFDFTSTIPSTPSSFDDFFLIPTPAKTSRRRFTVAPSDIIRLKRRLVQHRPNRGPISRTLSYLRSK
MDLALSTSSLYPSRDDVRQWEISFESLLNNKFGCALFRQFLKKEFSDENMDFWLECEEFKKMKDGKKSTTQKAIEIYSEF
VAEHSPKEVNLDSDTRAATKAAVEAGCKPDTFALAQSRVEQLMSKDSYRRFLRDRLFLDLLESYEITDKEDKPSSSKDKN
Estimated Isoelectric Point:
8.33039093017578
Estimated Molecular Weight:
27.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys20
Gln6
Leu22
Gly5
Met6
Ser31
Tyr5
His2
Glu16
Arg19
Cys3
Phe17
Pro11
Val7
Asn7
Ala15
Ile9
Trp2
Asp21