Sequence:
download
CE42072sequence.fasta
>CHE-11 MKPFLIEWAPHCGWICVVTQDETTGEANVAFSDHSGSVQEKGPSKPGSVSCVRWHPKKQFVVVGWKDGGVCFIPKGGNVS HTVVETYPFPNQGVDWSHDGTVLMTLHNPSSVHLYSYMVIGEEISTSNIMQIELNDQITLWCKRLSYDKFKPSKISVTDD DSGVDESPFGSKESLAERRDEKSTVPKGTEFLFAGKSGTIYGVDNDRQRTIHKLDSEILFMGYCETISIIIVFTRDCFIF HLAKGTSEMRCAERVKVKLGGKSEKYSLELDDGILVMCYGEKEIRVWDLIKEENGTIALDVNKGFQPDETINVVTVNGKR GVITAATSLNNIAEWKRKRTDTNVESAWNLSPSTHVDSQVSLIRWSPILSTAALITEEDLVLIGENSLTVKMRGKMAAIQ TSSNSFTLLHATSGVSQDLKLSIPSAKGICLGEKQLVVWNEDTVVTYDVQTSLATIQCTSFSCNTTSVAIVNQNLYCIEK DKIFARTLQGTLRQEISLPEIEGDPEILEVNRCWMAVATTNGFIRIYNLSAKDAQQEHNSKYIIENVKNFYKFHTIRINH TGNKVAVSYLEDVSTVAERLLVYDAELDAVSYFSFDRGMTDTQEYETQAELAHTSSGRPVTAAARKMAREQSRFQMMNHR PGAFEWDENDARYLVVECIHVEPESTDQRVLTAFVTSEHGIQLQGMQQKNLHCGKLVSVSVPNFYFVRKSGWDEEDNRDE RTIGKTLVAKCLREFLGNENCDESTRKAMMDFSFYLTIGSMDAAFKAIQFIKSDSVWDHMASMSIKTRRLDVAMVCLGHM KNVRGARAVRRSQQNGENDSMKCAALAIELSMLEEALIIYAQNERYDLMNKLYQSQNMWSSAFEIAETKDRIHLRNTHYN YAKYLEARRDQASIEAAIENYEKAGVHAFEVFRMLKDYPKQIEQYVRRKREESLYSWWGAYLESVGELEGAISFYSSAKD YYCMVRVKCIQGKTDEAARLAEESKDKAACYLIGRMYENDGDVVKAVKFFTKARALSSAIRLAKEHDMKDRLANLCLMAG GSELVSAARYYEDLPGYAHKAVMLYHKAGMIGRALDLAFRTEQFSALDLITKDLDAGTDPKILRRAAEFFENNQNYEKAV NFLCLAKEFSGAVQLCKNRNVRVSDKFAELMTPTKDDMPNVQERKQVLETVAELCLQQGAYSAAAKKFTQAGDKLSAMRA LLKSGDIQKIRFFANTARNKEIYILAANFLQTTDWQDNQQTMKDIETFYTKSQSFEHLGNFYKSVAIIEAEHLRTLDKSM GALEMAAVCVLEAEQKNMSTTGLDALKEDLKKYVVQLRKLQSVLEVMKNDAADGMRQLTTLAEESIDDDIVPCTRLFALI IEDHASRKNWKPAYRAITGLQKKVPNVDLETFVETSTLDKVCDEMRMERVTKKKKEEVESDGEEVDFSHSLRRQNVS
view sequence (1437 aa)
>CHE-11
MKPFLIEWAPHCGWICVVTQDETTGEANVAFSDHSGSVQEKGPSKPGSVSCVRWHPKKQFVVVGWKDGGVCFIPKGGNVS
HTVVETYPFPNQGVDWSHDGTVLMTLHNPSSVHLYSYMVIGEEISTSNIMQIELNDQITLWCKRLSYDKFKPSKISVTDD
DSGVDESPFGSKESLAERRDEKSTVPKGTEFLFAGKSGTIYGVDNDRQRTIHKLDSEILFMGYCETISIIIVFTRDCFIF
HLAKGTSEMRCAERVKVKLGGKSEKYSLELDDGILVMCYGEKEIRVWDLIKEENGTIALDVNKGFQPDETINVVTVNGKR
GVITAATSLNNIAEWKRKRTDTNVESAWNLSPSTHVDSQVSLIRWSPILSTAALITEEDLVLIGENSLTVKMRGKMAAIQ
TSSNSFTLLHATSGVSQDLKLSIPSAKGICLGEKQLVVWNEDTVVTYDVQTSLATIQCTSFSCNTTSVAIVNQNLYCIEK
DKIFARTLQGTLRQEISLPEIEGDPEILEVNRCWMAVATTNGFIRIYNLSAKDAQQEHNSKYIIENVKNFYKFHTIRINH
TGNKVAVSYLEDVSTVAERLLVYDAELDAVSYFSFDRGMTDTQEYETQAELAHTSSGRPVTAAARKMAREQSRFQMMNHR
PGAFEWDENDARYLVVECIHVEPESTDQRVLTAFVTSEHGIQLQGMQQKNLHCGKLVSVSVPNFYFVRKSGWDEEDNRDE
RTIGKTLVAKCLREFLGNENCDESTRKAMMDFSFYLTIGSMDAAFKAIQFIKSDSVWDHMASMSIKTRRLDVAMVCLGHM
KNVRGARAVRRSQQNGENDSMKCAALAIELSMLEEALIIYAQNERYDLMNKLYQSQNMWSSAFEIAETKDRIHLRNTHYN
YAKYLEARRDQASIEAAIENYEKAGVHAFEVFRMLKDYPKQIEQYVRRKREESLYSWWGAYLESVGELEGAISFYSSAKD
YYCMVRVKCIQGKTDEAARLAEESKDKAACYLIGRMYENDGDVVKAVKFFTKARALSSAIRLAKEHDMKDRLANLCLMAG
GSELVSAARYYEDLPGYAHKAVMLYHKAGMIGRALDLAFRTEQFSALDLITKDLDAGTDPKILRRAAEFFENNQNYEKAV
NFLCLAKEFSGAVQLCKNRNVRVSDKFAELMTPTKDDMPNVQERKQVLETVAELCLQQGAYSAAAKKFTQAGDKLSAMRA
LLKSGDIQKIRFFANTARNKEIYILAANFLQTTDWQDNQQTMKDIETFYTKSQSFEHLGNFYKSVAIIEAEHLRTLDKSM
GALEMAAVCVLEAEQKNMSTTGLDALKEDLKKYVVQLRKLQSVLEVMKNDAADGMRQLTTLAEESIDDDIVPCTRLFALI
IEDHASRKNWKPAYRAITGLQKKVPNVDLETFVETSTLDKVCDEMRMERVTKKKKEEVESDGEEVDFSHSLRRQNVS
Estimated Isoelectric Point:
5.89786529541016
Estimated Molecular Weight:
162.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr86
Lys103
Gln58
Leu114
Gly74
Met44
Ser106
Tyr47
His31
Glu114
Arg76
Cys30
Phe55
Pro30
Val103
Asn64
Ala117
Ile78
Trp20
Asp87