Sequence:
download
CE41710sequence.fasta
>RET-1, isoform f MNAENVDVELFFRKPPEITNFELVKTIWIDPKEETNSTNEPTSEHEPKSLQPLALQPLQTPESESGGSSCSHSEVEQLPD DILNEPLDDEVFEEEEENVQTDLLFRQPKNSEMELAYTISKSAEINLDELEFEDEEVEVDLLFREPTDRRFELVYTIPMM EDVSIDSQETITFEDIPPSEELDNVVEEVTDVAELTEFTFKPVEKDEQTETESFTTVLEANAGEGARDFIERVKLTSNDT LDDLDDDPEEETFQNSFVKSVDSKTPTPTGDNYEIEDSSVSDVLKDAAEKLQIIRNYSADLESEKDTINTDVQHVFIGLE DEGGVIPIIQETQEYVAEIGPTQDNQEYDSTSKSDLEPQSSADGVVETSTFEAPAVFGLEDSEDIINKHALETASNQEFS KIKEPEVTEVSENTAENLNEEVGESKNPEAIDLVESGENAGIEQNAGAEQSQKEAVEETSSFKAPAVIGLEESRDILKDP LLETAPDQENFNNKESEMTEIAEITTPIRLESSGDNFIGTDPEKGTEQIKGSESSELVTQEVIGLEESGDILKEPALETV TNQELSENKVSEVTEIAENITPIGLECSGDNFIGTDPEQQPEPIKGIESSELDVIGLEDSGDEVKQSQLKSSEDQEFSEL KEHDASGNVDETGESADIKQDDVTEIVQRETIGLEDSGLAEIVAAHEKNLTSSDIDSSVIPEDAENASPEAIGLESSGDN FIGTDLEHEEGQIDNCESYVLETAAVIGLEDSGENLKDSVQEDPPEKEFSENKESEVTGDVENTTAIGLESSGEHFIGLE QGQQAASIEANENSEMEAPAVIGLEDSGDNLNRPALETASDQESSENKEPDASENVEETEPVSSAKVIALESSGDCEEGN IKISANENSVEPDGADKPAHTEQEIPTIILPSETTVTQLEDHLSETEEKQNEVESSIKSEKNVIGLEDSGDTFRDTSGLA PAEDNEAEATITTDFVPLESAGDIPSENEIKEVASAPDVVGLEEYIIGNIPNAPVVNDDIPNVFTPEVANDETVETFSVT AEEASIPVVVELEPIGDEYEFQRPVENFSEPSDNINLEESGAEQVLLENNMFTPLDELEPQQKILNEKAEHIEIEASGDE FIKDHPFPVENEQNVNEQSSRVETVHSFIGLESSGVGLTGAVSDSVANNVKENTESPDIISLEASGDELSKLVEAREIIT ESKDAYSTDVPESRKTVSDVIGLEEAGDKIVSNNVSNVMGNPDESQLALEQADNVPELPIENSEQETVAVKATESCDHVV DSQKTLERASSLEEDIMSPEVLGITSSQTLSDYLPVISEDQDSIPVPVTEVEETSEKLVKASSLEEDVVSPEVLELDDRV QNKNPESEVTAVDASKTEGDFSDSPDSRATETFMEKLVTVTENLLPAGDKLSEERIQEIRENETISQPGKEEDDLENAND PDDETIVEKIVSMAESSLPIEAVISTEDGGTSDQPAQNAIPDSEETTVDDSQTEEIFTDDNVKKSKENTPKAENDTEINY LPGGEEGPEDNAEKRNEAVSPNDETSEIKQDLENLENGASGPDNNVQVDEAAQEDPTDPETVDETTSKISENMPKAPDTE DDNATEFIEAGLETTEAFGDAEHVSYLDANIEKLVAMADEPLPVDELVSIEERPEEVAPAESTGEDEDIFRRDRRTVSLT GTGDQNAPIQVIFVGDGDENPDANADQERTSEHNELIESDKESEEAITKNEEDVDQDPIQSEEPLTSQEGESSIGNKIVA VVGSVLLGGAVIPYGVLASNENEDAHADREVEETGDSTRDRPEEETFVSKLTSMVENILPSTNDENPEAVSMVENVLPVN TEGLDESKEDNPDAPTAEAHSGEKNLRNDKTTDTRERDPEEETILNKLVENALPTGVTGSFTEVSAPDAQELDETVVDHA GQNDTSEVEDAPEKSAGGTVIEKFTSMIESILPVQAPTQPENAESHIDQETGGASEIKDDQNQPEEFSAEHQGKFEVSAE PDQESAEFQLEAKKDQDKETIENSEDAKKETVMEKLVSLVENILPVEAVLPSDSTVTKNSEDKKELETQELSSKEIKTSG QPEYVPETSEAFVSDPEIFQRVKRASSTEPKTQKTEPHAPIFIVGQSTEDDEQSIANVIDELVHEDDEKKVPEVTANISV SASENIDDSTTANAVPKTEVSSEQLQVATVEFELESAPEEESAAIPEVQEPLEKVEVQPDLSQNSPAPHKIIDLHFNIPK DHEDYGNDYVPFGTESSEESQKADGNQENQEEEDVVAELNFHPIRQWRDEDVISLQSLKSLVAEVGCITDVDASDVNEQD EESTLKILKVVPSEPSLLELDFTNDPKVIHVPIPLMEPATMYLEEMVEWIIADAVKEVSEMEVVTESEISEMAPQVSEST CPIPEPLADLKLPVEDDEKTPEPEPVVPGQVQERIIPIEVEQAPTIPQRPPRAPKSELPKVAKPLDDSKSRVRFAPLNIK LGRTYSEEQQKELVESLERPLTIITQQKPPEKPTEDIGALSPLSPNTLAEYEEVPMMDMQSVPHSPQEKQEEIEALSEII EEPQAMKEVEKPVESAPEKDNESLEAPEIINEPIRRVLVETKIMGPGKSLNEDNDDDDDGSECLDSIGDLSERTIQRFNT SIDDPSIRRDSFSSISSFGDRQKFRTAIENIRQDLLPFQSSVSQYLRSSPNPSQQLLVTNLSMDSPSDLSPNAPPVGFEN TAQFLEKLQQEDRPSAEGSIDSSGFEKVDHEGLDEFAAPPVHDPMQKSVFGSLGSDDMKPGSQDDGFVFIERNEANEATL KKNQKMSSHHNDVIEKNYFNDNAPTAALLESPIAEEARKLVQDAVESASEYKKQAVDSGDEIGRELLDNVEQKIEQVKEP IVDSLHKAYDGVGDFVHETVPNAVDDFVREAEKQLPESPVPEKIETPEPLVDIHDTVDKVHDEVDNFLRREPTPPFETDD VAPLSDDKPQFGNQTPEEDETTFDRKGPLTIPEEVEKAAAAQNNDLDDFDPLVTSNTGAAFGAAVGAAAAVESLTEEEMF GHQKFETVPRPPTPPKDISDEDVKPSTVNLGPSHHHSHPSSPHHSILKHHGDAWIDFKTVPPCVLDVIYWRDAKKSAIVL SLALLVLFVLAKYPLLTVVTYSLLLALGAAAGFRSIFSVFKKVEAQIKKTDSEHPFSEILAQDLTLPQEKVHAQADVFVE HATCIANKLKKLVFVESPLESIKFGLVLWSLTYIASWFSGFTLAILGLLGVFSVPKVYESNQEAIDPHLATISGHLKNVQ NIIDEKLPFLRSAPVAAEEKKDQ
view sequence (3303 aa)
>RET-1, isoform f
MNAENVDVELFFRKPPEITNFELVKTIWIDPKEETNSTNEPTSEHEPKSLQPLALQPLQTPESESGGSSCSHSEVEQLPD
DILNEPLDDEVFEEEEENVQTDLLFRQPKNSEMELAYTISKSAEINLDELEFEDEEVEVDLLFREPTDRRFELVYTIPMM
EDVSIDSQETITFEDIPPSEELDNVVEEVTDVAELTEFTFKPVEKDEQTETESFTTVLEANAGEGARDFIERVKLTSNDT
LDDLDDDPEEETFQNSFVKSVDSKTPTPTGDNYEIEDSSVSDVLKDAAEKLQIIRNYSADLESEKDTINTDVQHVFIGLE
DEGGVIPIIQETQEYVAEIGPTQDNQEYDSTSKSDLEPQSSADGVVETSTFEAPAVFGLEDSEDIINKHALETASNQEFS
KIKEPEVTEVSENTAENLNEEVGESKNPEAIDLVESGENAGIEQNAGAEQSQKEAVEETSSFKAPAVIGLEESRDILKDP
LLETAPDQENFNNKESEMTEIAEITTPIRLESSGDNFIGTDPEKGTEQIKGSESSELVTQEVIGLEESGDILKEPALETV
TNQELSENKVSEVTEIAENITPIGLECSGDNFIGTDPEQQPEPIKGIESSELDVIGLEDSGDEVKQSQLKSSEDQEFSEL
KEHDASGNVDETGESADIKQDDVTEIVQRETIGLEDSGLAEIVAAHEKNLTSSDIDSSVIPEDAENASPEAIGLESSGDN
FIGTDLEHEEGQIDNCESYVLETAAVIGLEDSGENLKDSVQEDPPEKEFSENKESEVTGDVENTTAIGLESSGEHFIGLE
QGQQAASIEANENSEMEAPAVIGLEDSGDNLNRPALETASDQESSENKEPDASENVEETEPVSSAKVIALESSGDCEEGN
IKISANENSVEPDGADKPAHTEQEIPTIILPSETTVTQLEDHLSETEEKQNEVESSIKSEKNVIGLEDSGDTFRDTSGLA
PAEDNEAEATITTDFVPLESAGDIPSENEIKEVASAPDVVGLEEYIIGNIPNAPVVNDDIPNVFTPEVANDETVETFSVT
AEEASIPVVVELEPIGDEYEFQRPVENFSEPSDNINLEESGAEQVLLENNMFTPLDELEPQQKILNEKAEHIEIEASGDE
FIKDHPFPVENEQNVNEQSSRVETVHSFIGLESSGVGLTGAVSDSVANNVKENTESPDIISLEASGDELSKLVEAREIIT
ESKDAYSTDVPESRKTVSDVIGLEEAGDKIVSNNVSNVMGNPDESQLALEQADNVPELPIENSEQETVAVKATESCDHVV
DSQKTLERASSLEEDIMSPEVLGITSSQTLSDYLPVISEDQDSIPVPVTEVEETSEKLVKASSLEEDVVSPEVLELDDRV
QNKNPESEVTAVDASKTEGDFSDSPDSRATETFMEKLVTVTENLLPAGDKLSEERIQEIRENETISQPGKEEDDLENAND
PDDETIVEKIVSMAESSLPIEAVISTEDGGTSDQPAQNAIPDSEETTVDDSQTEEIFTDDNVKKSKENTPKAENDTEINY
LPGGEEGPEDNAEKRNEAVSPNDETSEIKQDLENLENGASGPDNNVQVDEAAQEDPTDPETVDETTSKISENMPKAPDTE
DDNATEFIEAGLETTEAFGDAEHVSYLDANIEKLVAMADEPLPVDELVSIEERPEEVAPAESTGEDEDIFRRDRRTVSLT
GTGDQNAPIQVIFVGDGDENPDANADQERTSEHNELIESDKESEEAITKNEEDVDQDPIQSEEPLTSQEGESSIGNKIVA
VVGSVLLGGAVIPYGVLASNENEDAHADREVEETGDSTRDRPEEETFVSKLTSMVENILPSTNDENPEAVSMVENVLPVN
TEGLDESKEDNPDAPTAEAHSGEKNLRNDKTTDTRERDPEEETILNKLVENALPTGVTGSFTEVSAPDAQELDETVVDHA
GQNDTSEVEDAPEKSAGGTVIEKFTSMIESILPVQAPTQPENAESHIDQETGGASEIKDDQNQPEEFSAEHQGKFEVSAE
PDQESAEFQLEAKKDQDKETIENSEDAKKETVMEKLVSLVENILPVEAVLPSDSTVTKNSEDKKELETQELSSKEIKTSG
QPEYVPETSEAFVSDPEIFQRVKRASSTEPKTQKTEPHAPIFIVGQSTEDDEQSIANVIDELVHEDDEKKVPEVTANISV
SASENIDDSTTANAVPKTEVSSEQLQVATVEFELESAPEEESAAIPEVQEPLEKVEVQPDLSQNSPAPHKIIDLHFNIPK
DHEDYGNDYVPFGTESSEESQKADGNQENQEEEDVVAELNFHPIRQWRDEDVISLQSLKSLVAEVGCITDVDASDVNEQD
EESTLKILKVVPSEPSLLELDFTNDPKVIHVPIPLMEPATMYLEEMVEWIIADAVKEVSEMEVVTESEISEMAPQVSEST
CPIPEPLADLKLPVEDDEKTPEPEPVVPGQVQERIIPIEVEQAPTIPQRPPRAPKSELPKVAKPLDDSKSRVRFAPLNIK
LGRTYSEEQQKELVESLERPLTIITQQKPPEKPTEDIGALSPLSPNTLAEYEEVPMMDMQSVPHSPQEKQEEIEALSEII
EEPQAMKEVEKPVESAPEKDNESLEAPEIINEPIRRVLVETKIMGPGKSLNEDNDDDDDGSECLDSIGDLSERTIQRFNT
SIDDPSIRRDSFSSISSFGDRQKFRTAIENIRQDLLPFQSSVSQYLRSSPNPSQQLLVTNLSMDSPSDLSPNAPPVGFEN
TAQFLEKLQQEDRPSAEGSIDSSGFEKVDHEGLDEFAAPPVHDPMQKSVFGSLGSDDMKPGSQDDGFVFIERNEANEATL
KKNQKMSSHHNDVIEKNYFNDNAPTAALLESPIAEEARKLVQDAVESASEYKKQAVDSGDEIGRELLDNVEQKIEQVKEP
IVDSLHKAYDGVGDFVHETVPNAVDDFVREAEKQLPESPVPEKIETPEPLVDIHDTVDKVHDEVDNFLRREPTPPFETDD
VAPLSDDKPQFGNQTPEEDETTFDRKGPLTIPEEVEKAAAAQNNDLDDFDPLVTSNTGAAFGAAVGAAAAVESLTEEEMF
GHQKFETVPRPPTPPKDISDEDVKPSTVNLGPSHHHSHPSSPHHSILKHHGDAWIDFKTVPPCVLDVIYWRDAKKSAIVL
SLALLVLFVLAKYPLLTVVTYSLLLALGAAAGFRSIFSVFKKVEAQIKKTDSEHPFSEILAQDLTLPQEKVHAQADVFVE
HATCIANKLKKLVFVESPLESIKFGLVLWSLTYIASWFSGFTLAILGLLGVFSVPKVYESNQEAIDPHLATISGHLKNVQ
NIIDEKLPFLRSAPVAAEEKKDQ
Estimated Isoelectric Point:
4.06038665771484
Estimated Molecular Weight:
362.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr202
Lys168
Gln137
Leu224
Gly141
Met32
Ser302
Tyr29
His51
Glu511
Arg68
Cys10
Phe95
Pro222
Val255
Asn165
Ala218
Ile192
Trp7
Asp274