Sequence:
download
CE41552sequence.fasta
>NRX-1, isoform i MVFLEHLRGGTPRGTTTVSPILCLMNWNDEQCRQQLKSYIPKFASNFDAPRHVPQPPSSPSYDYEGDEDEEKKEEKDHGI ADRSMNDVSGETTGRMCFGC
view sequence (100 aa)
>NRX-1, isoform i
MVFLEHLRGGTPRGTTTVSPILCLMNWNDEQCRQQLKSYIPKFASNFDAPRHVPQPPSSPSYDYEGDEDEEKKEEKDHGI
ADRSMNDVSGETTGRMCFGC
Estimated Isoelectric Point:
4.92321014404297
Estimated Molecular Weight:
11.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr6
Lys5
Gln4
Leu5
Gly8
Met4
Ser8
Tyr3
His3
Glu9
Arg6
Cys4
Phe4
Pro8
Val4
Asn4
Ala3
Ile3
Trp1
Asp8