Sequence:
download
CE41038sequence.fasta
>LGC-19, isoform a MILAIFSAIFMPIDSFFFDPELYVPKYKDFLDVQRNLTKHIFRDYDPTVSPVYTWVDVDLPIGYDNEAPKRYNYTIFLYY LKLVEVQEPQEKISVVMEIMEYWYDARLSWNASAWQNTTMIYMKQDKVWSPTISVFGVNDIVDFRDNDNRLICIENTGFI WDYVSVRVSANCEMDVSRFPFDTQICQIRFCLPIFYRVQVDILNEIYEEIMDERIFKTMGNSEWKLLNLTNRVEALVYND NMGTMDLAIFEITIRRNPLYYIYMIVFPSFIINFVSIVGVFLNGADKMSRLNVGLTNIMTMTFILGVMADKIPRTGNIPL LGIYIIINLVIMLIAIAIVTAITELRKWASPKLRKKKTALRAQLESFLGRPLEYTSAIILELMTCANFLVMVGFWFEDDS
view sequence (400 aa)
>LGC-19, isoform a
MILAIFSAIFMPIDSFFFDPELYVPKYKDFLDVQRNLTKHIFRDYDPTVSPVYTWVDVDLPIGYDNEAPKRYNYTIFLYY
LKLVEVQEPQEKISVVMEIMEYWYDARLSWNASAWQNTTMIYMKQDKVWSPTISVFGVNDIVDFRDNDNRLICIENTGFI
WDYVSVRVSANCEMDVSRFPFDTQICQIRFCLPIFYRVQVDILNEIYEEIMDERIFKTMGNSEWKLLNLTNRVEALVYND
NMGTMDLAIFEITIRRNPLYYIYMIVFPSFIINFVSIVGVFLNGADKMSRLNVGLTNIMTMTFILGVMADKIPRTGNIPL
LGIYIIINLVIMLIAIAIVTAITELRKWASPKLRKKKTALRAQLESFLGRPLEYTSAIILELMTCANFLVMVGFWFEDDS
Estimated Isoelectric Point:
4.88005828857422
Estimated Molecular Weight:
46.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr22
Lys17
Gln9
Leu35
Gly13
Met19
Ser19
Tyr21
His1
Glu21
Arg20
Cys5
Phe26
Pro17
Val32
Asn24
Ala19
Ile45
Trp9
Asp26