Sequence:
download
CE40504sequence.fasta
>DAF-10 MRPNLLWVDKILDENNEAGVCIYDLAFKPDGSELLLAADNKVYLFDVNEGGQMQTLKGHKDLVYTVAWSHNGELFASGGA DKLVILWNEKHEGTLRYSHTDVIQCMMFNPCNQILLTCALNEFGLWSTADKNVIKQRSVVRCCSCAWNTDGTIFAIGHGD GTITLRKGTNATEEPSIIIQRDNEPIWGIAFSSNRTFASRDSQGNPMGIDEIMAVIDWNKTLSFYSLDGTFIESKNLEFE PHCISYCLNGEYLLIGGSDKILKIYTRKGVLLGTVAQMDHWIWSVTVRPNSQTVAMGCVDGTIACYNLVFSTVHCVDHAR YANRKSMTDVFVQNLEYRTSSNICCHDLVKKMSLYDTKLAVQLSDKIQIYKQTGGVSKNERRKQLKYTLQDTIRKDLSFS LMVVTHGHLVVCNDEKLECYDFKGIKKRSWNMKSIVRYLRVLGGPAHRETLVLGTTDGGVYKVFIDNDYPILLDSRKTAI KCIDINANRTVLASIEDTLVCKWSDIATGETLLQEPGCYSVVFNTVNENLFAFTTNNMLHVRTLAAPGHTTRGVGYVLGF VKNRTFCLVQYNLIPLEVPYTIHLYQYIERGDFKEALRIACLGVVKNDWKYLANKALDALEFDVARKAYKRVRDRKMLRM VWELKKMKSNGEPDAILRATILAYTKKFREAAKIFKENGFENRAMELFTDMRMFDDVQEVMTTASGETKKMLMRKRASWA RDANQPKIAAEMLISSGDLDKAALLIIDNDWLELAIEISHKIDRSDLETMKKLSAYFIRKHEFGLASRIFQSINDMKSIV DMHVNAGHWTDAFAIADRHPKYVEDVYLPYARFLAERDRFEEAQKAFHRAGKEQEAMHVLEQLTSNSVNENRFADAGFYY WLLSQQYLDRSQTEENLTLLNKAKEAASLADAYYAYYPVFIFCSQPFSFERNENILNMARYLTFTPYIDNISKVFVYFTI AKIANEMGAYKSARTALDQLTNLRVLPQFELDGQIEVMTLNIRAKPFTDVESMQPMCYRCGLNNPLLGGMSCIHCETPFI ISFVSFDILPLIEFKIENDISFDEAKELIESEPPLSDDDYNPLRGLKKGIKEIILNRESLSKLEQGHVIIQTFPPPLAPK FLFNVMPSITIAQCKGCNKVFDLDDFEMACLRKGHCPFCRTSYDRNEAFFVDEEEDEDNTNIPSFGQFSRFS
view sequence (1192 aa)
>DAF-10
MRPNLLWVDKILDENNEAGVCIYDLAFKPDGSELLLAADNKVYLFDVNEGGQMQTLKGHKDLVYTVAWSHNGELFASGGA
DKLVILWNEKHEGTLRYSHTDVIQCMMFNPCNQILLTCALNEFGLWSTADKNVIKQRSVVRCCSCAWNTDGTIFAIGHGD
GTITLRKGTNATEEPSIIIQRDNEPIWGIAFSSNRTFASRDSQGNPMGIDEIMAVIDWNKTLSFYSLDGTFIESKNLEFE
PHCISYCLNGEYLLIGGSDKILKIYTRKGVLLGTVAQMDHWIWSVTVRPNSQTVAMGCVDGTIACYNLVFSTVHCVDHAR
YANRKSMTDVFVQNLEYRTSSNICCHDLVKKMSLYDTKLAVQLSDKIQIYKQTGGVSKNERRKQLKYTLQDTIRKDLSFS
LMVVTHGHLVVCNDEKLECYDFKGIKKRSWNMKSIVRYLRVLGGPAHRETLVLGTTDGGVYKVFIDNDYPILLDSRKTAI
KCIDINANRTVLASIEDTLVCKWSDIATGETLLQEPGCYSVVFNTVNENLFAFTTNNMLHVRTLAAPGHTTRGVGYVLGF
VKNRTFCLVQYNLIPLEVPYTIHLYQYIERGDFKEALRIACLGVVKNDWKYLANKALDALEFDVARKAYKRVRDRKMLRM
VWELKKMKSNGEPDAILRATILAYTKKFREAAKIFKENGFENRAMELFTDMRMFDDVQEVMTTASGETKKMLMRKRASWA
RDANQPKIAAEMLISSGDLDKAALLIIDNDWLELAIEISHKIDRSDLETMKKLSAYFIRKHEFGLASRIFQSINDMKSIV
DMHVNAGHWTDAFAIADRHPKYVEDVYLPYARFLAERDRFEEAQKAFHRAGKEQEAMHVLEQLTSNSVNENRFADAGFYY
WLLSQQYLDRSQTEENLTLLNKAKEAASLADAYYAYYPVFIFCSQPFSFERNENILNMARYLTFTPYIDNISKVFVYFTI
AKIANEMGAYKSARTALDQLTNLRVLPQFELDGQIEVMTLNIRAKPFTDVESMQPMCYRCGLNNPLLGGMSCIHCETPFI
ISFVSFDILPLIEFKIENDISFDEAKELIESEPPLSDDDYNPLRGLKKGIKEIILNRESLSKLEQGHVIIQTFPPPLAPK
FLFNVMPSITIAQCKGCNKVFDLDDFEMACLRKGHCPFCRTSYDRNEAFFVDEEEDEDNTNIPSFGQFSRFS
Estimated Isoelectric Point:
6.06993865966797
Estimated Molecular Weight:
136.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr67
Lys78
Gln36
Leu113
Gly62
Met35
Ser68
Tyr45
His26
Glu75
Arg61
Cys31
Phe62
Pro37
Val70
Asn68
Ala83
Ile80
Trp17
Asp78