Sequence:
download
CE40416sequence.fasta
>GOB-1 MNCEKESQMTIASQSIEDFKECLYQMQEARKSVTNEILETGHIKADQVQIFKSTLEEMNDERTSKNHIRDIHSRGTTFGI NIQDEIKGLQKDHHFLDAFAVESDKENNSFANVLKLCDLPGLLSKFVDDEIRFEKEVAECKAFLMDLIDTSTTGGIKPLF ITDWDGTMKDYCSQYATNLQPAYSAIVMGVFSRLFTRAFAVLTAGPLRHPGILDLTALPINGPVLFSGSWGREWWLGGRR IVHDDGIPEEGSVAIGQLCEQLDEILHEGEFVQFALVGSGVQRKVDRLTLGVQTVFKQVPEDLSARYIDAVRERIHRVDP NSQYLVLENCSPLEIEVCVHSSGAVWNKGDGVAALVESLHDSLKVGKVCVAGDTASDVPMLKKAADENPENVRALFVNIN KQLQENITNIVGDAKRVCFISSPDVAHAAFAQIISEFSG
view sequence (439 aa)
>GOB-1
MNCEKESQMTIASQSIEDFKECLYQMQEARKSVTNEILETGHIKADQVQIFKSTLEEMNDERTSKNHIRDIHSRGTTFGI
NIQDEIKGLQKDHHFLDAFAVESDKENNSFANVLKLCDLPGLLSKFVDDEIRFEKEVAECKAFLMDLIDTSTTGGIKPLF
ITDWDGTMKDYCSQYATNLQPAYSAIVMGVFSRLFTRAFAVLTAGPLRHPGILDLTALPINGPVLFSGSWGREWWLGGRR
IVHDDGIPEEGSVAIGQLCEQLDEILHEGEFVQFALVGSGVQRKVDRLTLGVQTVFKQVPEDLSARYIDAVRERIHRVDP
NSQYLVLENCSPLEIEVCVHSSGAVWNKGDGVAALVESLHDSLKVGKVCVAGDTASDVPMLKKAADENPENVRALFVNIN
KQLQENITNIVGDAKRVCFISSPDVAHAAFAQIISEFSG
Estimated Isoelectric Point:
4.97747039794922
Estimated Molecular Weight:
48.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr20
Lys24
Gln20
Leu38
Gly30
Met8
Ser30
Tyr6
His12
Glu34
Arg19
Cys10
Phe21
Pro14
Val36
Asn19
Ala32
Ile30
Trp5
Asp31