Sequence:
download
CE40260sequence.fasta
>AXL-1, isoform a MATMSRRWNYFTPHYNDEGSIDVLDGKPPYIDLFDPLKQPLFQHLRSMHTEFSTTTADVNTTWEDASSTSSSNKGATIWF NEDAIDKSSRHEIGQSTVTHESEDDRFSFFNAVCTRLNSLQETKNSSETEEHAESPRKEKSSTPYGTDGFAPPPRSTQTN TLKVSNLPKRFESLYKKKRQQVATSDSSGFGSNASDFWSFERYGKSNQGTLERPNRLFTGTNNGFSTLQPKRRGSEAPKM TVELRYENDVPMVAKISANHAQSVTLRYFRHLFGLHYTDNCRFFFKSTCEDGSAQYQWTLLFHDDDILPVFQNRITAICR MCPPPEDHDLI
view sequence (331 aa)
>AXL-1, isoform a
MATMSRRWNYFTPHYNDEGSIDVLDGKPPYIDLFDPLKQPLFQHLRSMHTEFSTTTADVNTTWEDASSTSSSNKGATIWF
NEDAIDKSSRHEIGQSTVTHESEDDRFSFFNAVCTRLNSLQETKNSSETEEHAESPRKEKSSTPYGTDGFAPPPRSTQTN
TLKVSNLPKRFESLYKKKRQQVATSDSSGFGSNASDFWSFERYGKSNQGTLERPNRLFTGTNNGFSTLQPKRRGSEAPKM
TVELRYENDVPMVAKISANHAQSVTLRYFRHLFGLHYTDNCRFFFKSTCEDGSAQYQWTLLFHDDDILPVFQNRITAICR
MCPPPEDHDLI
Estimated Isoelectric Point:
6.13562774658203
Estimated Molecular Weight:
37.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr31
Lys17
Gln13
Leu21
Gly15
Met6
Ser36
Tyr10
His11
Glu21
Arg21
Cys5
Phe22
Pro19
Val11
Asn19
Ala16
Ile10
Trp5
Asp22