Sequence:
download
CE40073sequence.fasta
>RGS-7, isoform e MTMASPRLSVPNELTMGDYYRSTGSSDMRGRSTNNLLDYTSASSSTNGSAGGPEKLKLHRATLPSITTTTSENNSDDAKS LSPEQSPTDHHFLCPDDNGGVYGAGPAHSAIKKSSVRRAASFTFSPKHSSSKTNLRQLNGREEDKEKKRFLGPISRTLSY LRSKMDLALSTSSLYPSRDDVRQWEISFESLLNNKFGCALFRQFLKKEFSDENMDFWLECEEFKKMKDGKKSTTQKAIEI YSEFVAEHSPKEVNLDSDTRAATKAAVEAGCKPDTFALAQSRVEQLMSKDSYRRFLRDRLFLDLLESYEITDKEDKPSSS KDKN
view sequence (324 aa)
>RGS-7, isoform e
MTMASPRLSVPNELTMGDYYRSTGSSDMRGRSTNNLLDYTSASSSTNGSAGGPEKLKLHRATLPSITTTTSENNSDDAKS
LSPEQSPTDHHFLCPDDNGGVYGAGPAHSAIKKSSVRRAASFTFSPKHSSSKTNLRQLNGREEDKEKKRFLGPISRTLSY
LRSKMDLALSTSSLYPSRDDVRQWEISFESLLNNKFGCALFRQFLKKEFSDENMDFWLECEEFKKMKDGKKSTTQKAIEI
YSEFVAEHSPKEVNLDSDTRAATKAAVEAGCKPDTFALAQSRVEQLMSKDSYRRFLRDRLFLDLLESYEITDKEDKPSSS
KDKN
Estimated Isoelectric Point:
8.18972015380859
Estimated Molecular Weight:
36.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr22
Lys28
Gln7
Leu30
Gly15
Met8
Ser46
Tyr9
His6
Glu23
Arg21
Cys4
Phe15
Pro14
Val8
Asn14
Ala21
Ile7
Trp2
Asp24