Sequence:
download
CE39465sequence.fasta
>SRI-20, isoform a MIMFTEAEVMSFSYAVDFGVPEWLKLYYHVISVVSTVISFFSMYIILFQSGKMDGYRFYLFYMQFAGWLMDLHLSTFMQF IPLFPVFGGYCTGLLTQIFRIDDSFQTTYTAFTICLVASALNSCFVRKHQAISKISSKYLLDNVTYCIVIFLLNIYPVIA ASLLYLSMLNKSEQVELVKSVYPNLVDKFASLPNYVVFDSNIWAIVFFAFIFFGCTYTLVLIVTTTYQMFKILDDNRKHI SASNYAKHRATLRSLLAQFTTCFLIVGPASLFSLLVVIRYEHSQVATHWTIVALTLHSSANAIVMVITYPPYRHFVMLWK TNRSFHFASSQYQRSTLPNTRIQTERSIAVTITTH
view sequence (355 aa)
>SRI-20, isoform a
MIMFTEAEVMSFSYAVDFGVPEWLKLYYHVISVVSTVISFFSMYIILFQSGKMDGYRFYLFYMQFAGWLMDLHLSTFMQF
IPLFPVFGGYCTGLLTQIFRIDDSFQTTYTAFTICLVASALNSCFVRKHQAISKISSKYLLDNVTYCIVIFLLNIYPVIA
ASLLYLSMLNKSEQVELVKSVYPNLVDKFASLPNYVVFDSNIWAIVFFAFIFFGCTYTLVLIVTTTYQMFKILDDNRKHI
SASNYAKHRATLRSLLAQFTTCFLIVGPASLFSLLVVIRYEHSQVATHWTIVALTLHSSANAIVMVITYPPYRHFVMLWK
TNRSFHFASSQYQRSTLPNTRIQTERSIAVTITTH
Estimated Isoelectric Point:
8.99176788330078
Estimated Molecular Weight:
40.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr29
Lys12
Gln13
Leu37
Gly9
Met12
Ser33
Tyr22
His11
Glu7
Arg12
Cys6
Phe32
Pro10
Val31
Asn12
Ala23
Ile29
Trp5
Asp10