Sequence:
download
CE39394sequence.fasta
>R05F9.7 MHIIQEFLAKILSLLAEPIPLVEGQWLNITFDVPILVDINAPLTPTLQFIYASESILICVGMFLMVYFNYFVKSFQIVHL NLQYLFLLFTTLYIFGSLARFYMILVQLKFVTDLDTPYLLVAGILRMEHYGVSLSAILVVTIERAFATYYVVDYETKHRC WVAAFCALVSLTYTQCFVIPICFFEASLLYIILFASLWAVFSNIVLMCLYYYNVQESKRLSWKAENLRKMKNVNYTLSKK FQVEENVKIIKYLQVMSSMLVFLIFFVIIFIVVPRVYLGSKTYSGQVMISLFDINLALGAILIPSVCVLHLRKTRDMPFS GKIHCLNKRRDDRQVNPITVFEDVTKSYFDQFQTSWR
view sequence (357 aa)
>R05F9.7
MHIIQEFLAKILSLLAEPIPLVEGQWLNITFDVPILVDINAPLTPTLQFIYASESILICVGMFLMVYFNYFVKSFQIVHL
NLQYLFLLFTTLYIFGSLARFYMILVQLKFVTDLDTPYLLVAGILRMEHYGVSLSAILVVTIERAFATYYVVDYETKHRC
WVAAFCALVSLTYTQCFVIPICFFEASLLYIILFASLWAVFSNIVLMCLYYYNVQESKRLSWKAENLRKMKNVNYTLSKK
FQVEENVKIIKYLQVMSSMLVFLIFFVIIFIVVPRVYLGSKTYSGQVMISLFDINLALGAILIPSVCVLHLRKTRDMPFS
GKIHCLNKRRDDRQVNPITVFEDVTKSYFDQFQTSWR
Estimated Isoelectric Point:
8.76340484619141
Estimated Molecular Weight:
41.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr18
Lys17
Gln14
Leu48
Gly9
Met11
Ser23
Tyr21
His6
Glu13
Arg13
Cys8
Phe29
Pro11
Val36
Asn13
Ala18
Ile33
Trp5
Asp11