Sequence:
download
CE39181sequence.fasta
>DOP-3, isoform d MVVLWRVAAGVFLPLVPTMAVFGNVLVIMSVFRERSLQTVTNMLIVSLAVSDFMVAIGVMSFGVYYEWNDFKWGLGSFFC HVYQALDVACSTASILNLLAISLDRYIAIGHPISYAQYGARGGRAMISITIVWGVSVAVALPLLLGVNPMEENDLQECEL ANPYFNMISSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSENDKISSALLGGAQIARQMGKHFKNRTDQILLE ISFQV
view sequence (245 aa)
>DOP-3, isoform d
MVVLWRVAAGVFLPLVPTMAVFGNVLVIMSVFRERSLQTVTNMLIVSLAVSDFMVAIGVMSFGVYYEWNDFKWGLGSFFC
HVYQALDVACSTASILNLLAISLDRYIAIGHPISYAQYGARGGRAMISITIVWGVSVAVALPLLLGVNPMEENDLQECEL
ANPYFNMISSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSENDKISSALLGGAQIARQMGKHFKNRTDQILLE
ISFQV
Estimated Isoelectric Point:
8.97969818115234
Estimated Molecular Weight:
27.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr7
Lys4
Gln11
Leu26
Gly15
Met11
Ser20
Tyr8
His3
Glu9
Arg16
Cys4
Phe15
Pro7
Val23
Asn10
Ala22
Ile23
Trp4
Asp7