Sequence:
download
CE39180sequence.fasta
>DOP-3, isoform c MVVLWRVAAGVFLPLVPTMAVFGNVLVIMSVFRERSLQTVTNMLIVSLAVSDFMVAIGVMSFGVYYEWNDFKWGLGSFFC HVYQALDVACSTASILNLLAISLDRYIAIGHPISYAQYGARGGRAMISITIVWGVSVAVALPLLLGVNPMEENDECELAN PYFNMISSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSENDKISSALLGGAQIARQMGKHFKNRTDQILLEIS FQTSSFPTMSESSEDASTISPMINSFNNFLPKKTPYPSTSIPAIPECGSMPNLTIIERPEAEKEKEISIMDLRDTVEMLD DKYSSAILTSFQTSRSFGEELEEILPFIDGSNSVKHSREQLHTTRSNTSTTRLLDVKPELRSISVPSIQDEKKLSQKSND LPFSHQNGTHKQKLLPNPGILMKSKSTTLLKTNGYMDTDSLNRNSHKKSLADLLANDEFSFSDSMRVYKNRLFKSLSRAT SGWNKPRPSRHMVKKATKQMRREHKATVTLAVVLAVFLFCWLPFFVLHLSNSICLIIDENSACVGFLPLYLATWLGYLNS SLNPLIYTVFDQRFRNAFRNILSCGIFKKR
view sequence (590 aa)
>DOP-3, isoform c
MVVLWRVAAGVFLPLVPTMAVFGNVLVIMSVFRERSLQTVTNMLIVSLAVSDFMVAIGVMSFGVYYEWNDFKWGLGSFFC
HVYQALDVACSTASILNLLAISLDRYIAIGHPISYAQYGARGGRAMISITIVWGVSVAVALPLLLGVNPMEENDECELAN
PYFNMISSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSENDKISSALLGGAQIARQMGKHFKNRTDQILLEIS
FQTSSFPTMSESSEDASTISPMINSFNNFLPKKTPYPSTSIPAIPECGSMPNLTIIERPEAEKEKEISIMDLRDTVEMLD
DKYSSAILTSFQTSRSFGEELEEILPFIDGSNSVKHSREQLHTTRSNTSTTRLLDVKPELRSISVPSIQDEKKLSQKSND
LPFSHQNGTHKQKLLPNPGILMKSKSTTLLKTNGYMDTDSLNRNSHKKSLADLLANDEFSFSDSMRVYKNRLFKSLSRAT
SGWNKPRPSRHMVKKATKQMRREHKATVTLAVVLAVFLFCWLPFFVLHLSNSICLIIDENSACVGFLPLYLATWLGYLNS
SLNPLIYTVFDQRFRNAFRNILSCGIFKKR
Estimated Isoelectric Point:
9.27140045166016
Estimated Molecular Weight:
66.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr32
Lys30
Gln18
Leu64
Gly25
Met21
Ser66
Tyr15
His11
Glu28
Arg35
Cys9
Phe34
Pro27
Val35
Asn31
Ala36
Ile43
Trp7
Asp23