Sequence:
download
CE39178sequence.fasta
>DOP-3, isoform a MLAGQHHVTDIESPLMVVLWRVAAGVFLPLVPTMAVFGNVLVIMSVFRERSLQTVTNMLIVSLAVSDFMVAIGVMSFGVY YEWNDFKWGLGSFFCHVYQALDVACSTASILNLLAISLDRYIAIGHPISYAQYGARGGRAMISITIVWGVSVAVALPLLL GVNPMEENDECELANPYFNMISSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSENDKISSALLGGAQIARQMG KHFKNRTDQILLEISFQTSSFPTMSESSEDASTISPMINSFNNFLPKKTPYPSTSIPAIPECGSMPNLTIIERPEAEKEK EISIMDLRDTVEMLDDKYSSAILTSFQTSRSFGEELEEILPFIDGSNSVKHSREQLHTTRSNTSTTRLLDVKPELRSISV PSIQDEKKLSQKSNDLPFSHQNGTHKQKLLPNPGILMKSKSTTLLKTNGYMDTDSLNRNSHKKSLADLLANDEFSFSDSM RVYKNRLFKSLSRATSGWNKPRPSRHMVKKATKQMRREHKATVTLAVVLAVFLFCWLPFFVLHLSNSICLIIDENSACVG FLPLYLATWLGYLNSSLNPLIYTVFDQRFRNAFRNILSCGIFKKR
view sequence (605 aa)
>DOP-3, isoform a
MLAGQHHVTDIESPLMVVLWRVAAGVFLPLVPTMAVFGNVLVIMSVFRERSLQTVTNMLIVSLAVSDFMVAIGVMSFGVY
YEWNDFKWGLGSFFCHVYQALDVACSTASILNLLAISLDRYIAIGHPISYAQYGARGGRAMISITIVWGVSVAVALPLLL
GVNPMEENDECELANPYFNMISSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSENDKISSALLGGAQIARQMG
KHFKNRTDQILLEISFQTSSFPTMSESSEDASTISPMINSFNNFLPKKTPYPSTSIPAIPECGSMPNLTIIERPEAEKEK
EISIMDLRDTVEMLDDKYSSAILTSFQTSRSFGEELEEILPFIDGSNSVKHSREQLHTTRSNTSTTRLLDVKPELRSISV
PSIQDEKKLSQKSNDLPFSHQNGTHKQKLLPNPGILMKSKSTTLLKTNGYMDTDSLNRNSHKKSLADLLANDEFSFSDSM
RVYKNRLFKSLSRATSGWNKPRPSRHMVKKATKQMRREHKATVTLAVVLAVFLFCWLPFFVLHLSNSICLIIDENSACVG
FLPLYLATWLGYLNSSLNPLIYTVFDQRFRNAFRNILSCGIFKKR
Estimated Isoelectric Point:
9.15775299072266
Estimated Molecular Weight:
68.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr33
Lys30
Gln19
Leu66
Gly26
Met22
Ser67
Tyr15
His13
Glu29
Arg35
Cys9
Phe34
Pro28
Val36
Asn31
Ala37
Ile44
Trp7
Asp24