Sequence:
download
CE39109sequence.fasta
>MEC-4 MSWMQNLKNYQHLRDPSEYMSQVYGDPLAYLQETTKFVTEREYYEDFGYGECFNSTESEVQCELITGEFDPKLLPYDKRL AWHFKEFCYKTSAHGIPMIGEAPNVYYRAVWVVLFLGCMIMLYLNAQSVLDKYNRNEKIVDIQLKFDTAPFPAITLCNLN PYKASLATSVDLVKRTLSAFDGAMGKAGGNKDHEEEREVVTEPPTTPAPTTKPARRRGKRDLSGAFFEPGFARCLCGSQG SSEQEDKDEEKEEELLETTTKKVFNINDADEEWDGMEEYDNEHYENYDVEATTGMNMMEECQSERTKFDEPTGFDDRCIC AFDRSTHDAWPCFLNGTWETTECDTCNEHAFCTKDNKTAKGHRSPCICAPSRFCVAYNGKTPPIEIWTYLQGGTPTEDPN FLEAMGFQGMTDEVAIVTKAKENIMFAMATLSMQDRERLSTTKRELVHKCSFNGKACDIEADFLTHIDPAFGSCFTFNHN RTVNLTSIRAGPMYGLRMLVYVNASDYMPTTEATGVRLTIHDKEDFPFPDTFGYSAPTGYVSSFGLRLRKMSRLPAPYGD CVPDGKTSDYIYSNYEYSVEGCYRSCFQQLVLKECRCGDPRFPVPENARHCDAADPIARKCLDARMNDLGGLHGSFRCRC QQPCRQSIYSVTYSPAKWPSLSLQIQLGSCNGTAVECNKHYKENGAMVEVFYEQLNFEMLTESEAYGFVNLLADFGGQLG LWCGISFLTCCEFVFLFLETAYMSAEHNYSLYKKKKAEKAKKIASGSF
view sequence (768 aa)
>MEC-4
MSWMQNLKNYQHLRDPSEYMSQVYGDPLAYLQETTKFVTEREYYEDFGYGECFNSTESEVQCELITGEFDPKLLPYDKRL
AWHFKEFCYKTSAHGIPMIGEAPNVYYRAVWVVLFLGCMIMLYLNAQSVLDKYNRNEKIVDIQLKFDTAPFPAITLCNLN
PYKASLATSVDLVKRTLSAFDGAMGKAGGNKDHEEEREVVTEPPTTPAPTTKPARRRGKRDLSGAFFEPGFARCLCGSQG
SSEQEDKDEEKEEELLETTTKKVFNINDADEEWDGMEEYDNEHYENYDVEATTGMNMMEECQSERTKFDEPTGFDDRCIC
AFDRSTHDAWPCFLNGTWETTECDTCNEHAFCTKDNKTAKGHRSPCICAPSRFCVAYNGKTPPIEIWTYLQGGTPTEDPN
FLEAMGFQGMTDEVAIVTKAKENIMFAMATLSMQDRERLSTTKRELVHKCSFNGKACDIEADFLTHIDPAFGSCFTFNHN
RTVNLTSIRAGPMYGLRMLVYVNASDYMPTTEATGVRLTIHDKEDFPFPDTFGYSAPTGYVSSFGLRLRKMSRLPAPYGD
CVPDGKTSDYIYSNYEYSVEGCYRSCFQQLVLKECRCGDPRFPVPENARHCDAADPIARKCLDARMNDLGGLHGSFRCRC
QQPCRQSIYSVTYSPAKWPSLSLQIQLGSCNGTAVECNKHYKENGAMVEVFYEQLNFEMLTESEAYGFVNLLADFGGQLG
LWCGISFLTCCEFVFLFLETAYMSAEHNYSLYKKKKAEKAKKIASGSF
Estimated Isoelectric Point:
5.06868743896484
Estimated Molecular Weight:
87.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr54
Lys44
Gln22
Leu55
Gly50
Met24
Ser45
Tyr38
His16
Glu66
Arg36
Cys35
Phe44
Pro39
Val34
Asn35
Ala53
Ile24
Trp9
Asp45