Sequence:
download
CE38712sequence.fasta
>RME-6, isoform a MADIIERIRSQDEYREFYELATKIRNQKLLTDAELHSLNRHQQEVSDNEIKLLTEAWRSSYWNNVGRQLKNQALEPTIAC RLLKEISETEALPAYKHVGHHFSTLDQLLTILYNEPQSVAELLNSIDRNDITSNDSTIQVLFHLVYSCALYPEDELKIAQ VVCNLLKLQLYRSGSEMRTILRKETSISTRFYKHFVELIHPTMVYLTKALRKGVLDVIQLGSFWLDIDAKQSTARFLRDN KQNEDRLPEYRALVVSKLVDFVDTFLENISKALPMLPPNLNWIIRDIFCSLYEVVDDVSAIELSHACKDMIVSNLICPAI ISPQKFGVVDNDVRVGTIVNHNLVQIAMIIQMISLREFESPPEEYKEFLSQCRNTHLISEMMDALLVEKLAPDVEITSLI ANGTAESDMATKSSFVGTVADVNVLIKIIRNAPSTSDAKLSRILSVCDKLPATISSTTQKSHFDNLEASPKISTLRNIHR KVQHSFKRTGDSFNDINELGAKQGEALAFGKENFDLFYLEYSPKNYKDVAEADRLKKKAEERRQLADLEKLLEPTPAPKE TPVENNLIDFSSGSAETNSEHLSDSTSVSPEPLTSTEELQIGDQGVGGEQRGKLAKLKSLSDRMKKGITQSNTLSDIREH LRRSGSFVKPPPSGIPTSSSEQNLPDVATGPRDDILAKYASISSIKEQKPALGNLIDGTASASSTPRKEPLEPYYSSENL VGCRAFQDTLRKMITVLGNISYLPRIGYRNETKQNEWDKKVLLGRFLDGVLVETEHRREYGLAAQLREVKRCIELFEHAG VEILMDHLKLNEAEQDKIVNGMREERASLMRKSNDISSLEQRVLLNRRLTEQILVDFLMRTFLETGFNNKHTVGKTQEVT AVLKFYDEFKYLRAQDERAEFLKNLLTFLRDRLMQNVDWNFATDTMMSRAMTTIERYVIFAVYDNAFYPNRDADHHRDKL LRGTIAKVSDVVTPVNDFLKIPEHLHGEAPWPSAQAELSMLDIYVTAQDKLNCVVRCCDVINNLVALSSKNAVASADDLT PVLVFVIIKANPRALLSNVQFVETFAGDRIESGRDAYYWVNFKSAVEYIKTIL
view sequence (1093 aa)
>RME-6, isoform a
MADIIERIRSQDEYREFYELATKIRNQKLLTDAELHSLNRHQQEVSDNEIKLLTEAWRSSYWNNVGRQLKNQALEPTIAC
RLLKEISETEALPAYKHVGHHFSTLDQLLTILYNEPQSVAELLNSIDRNDITSNDSTIQVLFHLVYSCALYPEDELKIAQ
VVCNLLKLQLYRSGSEMRTILRKETSISTRFYKHFVELIHPTMVYLTKALRKGVLDVIQLGSFWLDIDAKQSTARFLRDN
KQNEDRLPEYRALVVSKLVDFVDTFLENISKALPMLPPNLNWIIRDIFCSLYEVVDDVSAIELSHACKDMIVSNLICPAI
ISPQKFGVVDNDVRVGTIVNHNLVQIAMIIQMISLREFESPPEEYKEFLSQCRNTHLISEMMDALLVEKLAPDVEITSLI
ANGTAESDMATKSSFVGTVADVNVLIKIIRNAPSTSDAKLSRILSVCDKLPATISSTTQKSHFDNLEASPKISTLRNIHR
KVQHSFKRTGDSFNDINELGAKQGEALAFGKENFDLFYLEYSPKNYKDVAEADRLKKKAEERRQLADLEKLLEPTPAPKE
TPVENNLIDFSSGSAETNSEHLSDSTSVSPEPLTSTEELQIGDQGVGGEQRGKLAKLKSLSDRMKKGITQSNTLSDIREH
LRRSGSFVKPPPSGIPTSSSEQNLPDVATGPRDDILAKYASISSIKEQKPALGNLIDGTASASSTPRKEPLEPYYSSENL
VGCRAFQDTLRKMITVLGNISYLPRIGYRNETKQNEWDKKVLLGRFLDGVLVETEHRREYGLAAQLREVKRCIELFEHAG
VEILMDHLKLNEAEQDKIVNGMREERASLMRKSNDISSLEQRVLLNRRLTEQILVDFLMRTFLETGFNNKHTVGKTQEVT
AVLKFYDEFKYLRAQDERAEFLKNLLTFLRDRLMQNVDWNFATDTMMSRAMTTIERYVIFAVYDNAFYPNRDADHHRDKL
LRGTIAKVSDVVTPVNDFLKIPEHLHGEAPWPSAQAELSMLDIYVTAQDKLNCVVRCCDVINNLVALSSKNAVASADDLT
PVLVFVIIKANPRALLSNVQFVETFAGDRIESGRDAYYWVNFKSAVEYIKTIL
Estimated Isoelectric Point:
5.80750274658203
Estimated Molecular Weight:
124.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr61
Lys68
Gln40
Leu124
Gly39
Met21
Ser87
Tyr31
His24
Glu84
Arg66
Cys13
Phe40
Pro42
Val73
Asn59
Ala74
Ile70
Trp8
Asp69