Sequence:
download
CE38225sequence.fasta
>SRSX-33 MPEISPLLIPIALFYLLCALVSMAGNIVMVVCFLKERKFNSPCHYLITLTCIADMLHLCGHFVFNFQLFYQGPGSQELCF WLLLPSTIGLLMSGPLLLSMGIDRLIACQLPVFYRQLCSRPSFYLCIQLSFPIIYTSYITVISFLQRDSETMVICQVPLA MSGNSFELFNQGGLLINVAVVLIYFTTYIKLKKVTANASQLKTVFKSILYTVIFVILGWCTVTVVNIGCIHLVENIENQH IISIYAGIGLNLACVSNVFVFYTINSEYRSAIRKLIGKVDLAKIKPTTSIVKSTTRQNMSGKY
view sequence (303 aa)
>SRSX-33
MPEISPLLIPIALFYLLCALVSMAGNIVMVVCFLKERKFNSPCHYLITLTCIADMLHLCGHFVFNFQLFYQGPGSQELCF
WLLLPSTIGLLMSGPLLLSMGIDRLIACQLPVFYRQLCSRPSFYLCIQLSFPIIYTSYITVISFLQRDSETMVICQVPLA
MSGNSFELFNQGGLLINVAVVLIYFTTYIKLKKVTANASQLKTVFKSILYTVIFVILGWCTVTVVNIGCIHLVENIENQH
IISIYAGIGLNLACVSNVFVFYTINSEYRSAIRKLIGKVDLAKIKPTTSIVKSTTRQNMSGKY
Estimated Isoelectric Point:
8.92298126220703
Estimated Molecular Weight:
34.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr18
Lys13
Gln12
Leu41
Gly16
Met9
Ser24
Tyr14
His5
Glu8
Arg8
Cys13
Phe19
Pro12
Val25
Asn14
Ala13
Ile33
Trp2
Asp4