Sequence:
download
CE37906sequence.fasta
>ITR-1, isoform d MRKSSMALPSRKLTIANSIDHGNNGNLHIGDIISLYTESSSNQEQRGFLSTLGLVDDRCIVELKDGRPESPPKKFRDCLF KVCPVNRYAAQKHLWTEQKRFQTGDSMFDDDLMNKLKVAADKEREENESEFQKTLGNVIQYGSMVQLLHVKSNKYITVQK NSPAKRERNAMKVYLDRAGNEGSWFIIEPAYKHYAIGDNVSAGNKISLIPNSVSTTQAGHVKSQLHLSSFNLLDHQSAAE VNCLNEPTEWQVFMFLLFDENQQNSVKSGDVVRLFHADQQTFLTLDTIPKQNPPTDVVFLRMTNRPSAADATSSRALWEV QVVQTNAYRGGTAKWNKAYRFKHLATDMYLSAEPSQVQVKPAMNGRRASLIYSKTNNPMAMYSDGPNGVTNESTDTTQQN IPSVWVLGPTKSEFPEEDANLLFQLDPSTFMKSNKEVPRRSYVRLLHQSSDKWVHATNATEKQNLHYSSKNEKGWVKVIC EKNRVDKETFALLPVNPDEVRDLDFANDACKALRNFIKLIKIGQVISKESINSTTQLLIDCILFVTNSSDHLADPLKISD FSPSRDRQKLLREQEVLNQVFLLLKAPFLPRQGTTELGPLLSSPSELSDSRNEIFKTMFQLCYCLLKYSQVSYRKNQEFL AEKFGEIQEQIGFDLMAEDTMTAVLHNNPKLLEKYVKTPHVERFVELVRNNRQGKFLDYLADLCVCRGEANKKIQELICT SVLSSKHRDIFMDTKIIDGEIEVGWAPNFRKLVDIAEGAKSNSDDAEHLDYYRHQLDLLSQMCQEQQYLAIDPPPERRLM NISQQLPAELVLQCMSDNRLPYDLRGSFTRLMLHLHVVRGSPMSAIRHARLWWSIPENVNVSTYESVSVEAYSDGSRMRI GEGIAHKVLATVETYLMGLRNQSMEERQSVNSSKLTYEIVNLAKALAQFNFYSFNDLLQLTQNLLAIINEGPATEQVPSH RAMVNAIRNMSKSMMRGGNKENSKDLAKTPSVTAEEAGRTKEGRALNVKTKLIVAEILQFVMDVRRDYRITMALSWFKNV FPCDEDGSLMHSASINERMASELYDAIYRSSGHELHLDGRDGQLLLAILLQMTMSDYPPLTSIALKVFFRHFTQYQELLE DLKQVQLLVSNNDVENYRQIDRDLFILKNLTEKSELWVHGDRHHSIDTKEVDEKERTTEHDLLDHDLKSPRAFDSGDSME ALMAVLNEHYPSIRNECLQLLNRLLIKDDRNDAAVALQELSDKAPLIAYPLIRQMLVRLTGMCYRKGDPKPDTMNQQLLK NMRVYEVVLEFISVPHDKKHDHDMMKLITLSHEFLRSFCKTNKENQSRLYKFISYEKDAKEGMLRVETIEEVGTLVAIFR NNRELASNVPEELIAHIVGLIEHNSRNPIFLELLQALVCVYDKEIESGQEKVANEICAASDEVRQLYVDNASFEELEAMM KDEKESKGRSSDSRRKLKYHIELVRLLAMCTRGKNGNTELKCASQIPMDHIVRVVTAKQCLVEVKTVYLQLLLHCYIDTD AEMKDAYKTEYVDHILNNLLEDIRSLRVEKLTGAETATLEHYICHTVTEVLIKFFEAPYSALQQAKVDVHHHKKTFSEVL LELTYLEKGKLRGSKSSRNWYRVAECIKRLTKWAEEHNITLPATLAGPQMSGQTSVRQKWQQAASSAKWIGIGKRLNRQN TLNPGHRLYGTSNSMTEHTSANVVTCYHMMIGEFKFYLHPLHAAEGSVLVEVLHTPELLFPEGSALRDQCARGGVVAKLI QHCKTLMQNKQDNLCARVLQTLCKMCDCTKQQLTHQGQQLRQLLLQRYFGHHNNHHPPLDRQQSKIGEVIEAVKEKKEET WSQERDLYAIQCKLNDAGASDLVTDIIIMEPSREIFLKAIHLARALLHEGNDKVQHSFYMRMKQKDIHEPFFKAILTRIQ TAQNRLKSDMMSCSDSKPKVSLSATVSRRSSTVLTPLIDAGDTGFNGALFEVPQQVRHPSISEMSQLSNDLTHSIPDLAP YQDEEKSTDALPPEVALVEPILRVLQLLCENHNSLLQNFLRKQSDRTNHNLVSETLSFLDTVCGSTKGSLGVFGEIGEHN FSLITQTLATLTEFCQGPCHENQNTMAMQENGLNIIISLVLNEIKPLADDHMELALEIKSQASKLLLAIMESRHDGENAN RVLRNMANMSGGPKQLVHAIKQAYEMTNSNHHMLKSISRDLFRQAEDDLKKKSGPQITVNTVTLPEINVDASGIVSIHTE KNISSSLDDKFNDDDIPSVDPREVGHNIYILAHQLAIHDGELEIWLDGSDEKKDDLTREALNYYKERTAQIEIVRRDRTL ERVVFPINDICSYLTKDTKDYVYNNTERDNQGSKVTEFFDEWETMYHEMIWQRKLQDRKWLSWCAFRLPLWTRLSFHFAF IVNALVARYYPLPEHSNSSISLGNLYSWFAVFSSFLLAHYLRHDKIYLHKTSLLILASLCFLLLSSIGVTLTLYIFGILQ LVNKIVHVVAFVSNKGLEDRPIAEILACRNLHYLLVYLFICILGLLVHPMIYCILLFDIIFTEETLQNVIASVTRNYQSI VWTGLLALILLYFFSILGFLYFRHDFYLEVDPVENDSSATISSGIPSETCPSEGCPGLQPSEKDDNDDEKKVKSCETLWM CILQTGYQGLRNGGGIGDVLRNPAPWEDMFIWRVAYDMTFFVVLIVIVLNLIFGVIIDTFGDLRAEKNEKEQILKNNCFI CGLDRSRFDNRSVTFETHRETEHNIWHYLYYIVMLQIKDETEFTGPESYVAQCVKDRNLDWFPRMQALSLQDSELDTDQS EVKQMKDQLLQMMTLMREIISQNEESRAFMEQFQPR
view sequence (2836 aa)
>ITR-1, isoform d
MRKSSMALPSRKLTIANSIDHGNNGNLHIGDIISLYTESSSNQEQRGFLSTLGLVDDRCIVELKDGRPESPPKKFRDCLF
KVCPVNRYAAQKHLWTEQKRFQTGDSMFDDDLMNKLKVAADKEREENESEFQKTLGNVIQYGSMVQLLHVKSNKYITVQK
NSPAKRERNAMKVYLDRAGNEGSWFIIEPAYKHYAIGDNVSAGNKISLIPNSVSTTQAGHVKSQLHLSSFNLLDHQSAAE
VNCLNEPTEWQVFMFLLFDENQQNSVKSGDVVRLFHADQQTFLTLDTIPKQNPPTDVVFLRMTNRPSAADATSSRALWEV
QVVQTNAYRGGTAKWNKAYRFKHLATDMYLSAEPSQVQVKPAMNGRRASLIYSKTNNPMAMYSDGPNGVTNESTDTTQQN
IPSVWVLGPTKSEFPEEDANLLFQLDPSTFMKSNKEVPRRSYVRLLHQSSDKWVHATNATEKQNLHYSSKNEKGWVKVIC
EKNRVDKETFALLPVNPDEVRDLDFANDACKALRNFIKLIKIGQVISKESINSTTQLLIDCILFVTNSSDHLADPLKISD
FSPSRDRQKLLREQEVLNQVFLLLKAPFLPRQGTTELGPLLSSPSELSDSRNEIFKTMFQLCYCLLKYSQVSYRKNQEFL
AEKFGEIQEQIGFDLMAEDTMTAVLHNNPKLLEKYVKTPHVERFVELVRNNRQGKFLDYLADLCVCRGEANKKIQELICT
SVLSSKHRDIFMDTKIIDGEIEVGWAPNFRKLVDIAEGAKSNSDDAEHLDYYRHQLDLLSQMCQEQQYLAIDPPPERRLM
NISQQLPAELVLQCMSDNRLPYDLRGSFTRLMLHLHVVRGSPMSAIRHARLWWSIPENVNVSTYESVSVEAYSDGSRMRI
GEGIAHKVLATVETYLMGLRNQSMEERQSVNSSKLTYEIVNLAKALAQFNFYSFNDLLQLTQNLLAIINEGPATEQVPSH
RAMVNAIRNMSKSMMRGGNKENSKDLAKTPSVTAEEAGRTKEGRALNVKTKLIVAEILQFVMDVRRDYRITMALSWFKNV
FPCDEDGSLMHSASINERMASELYDAIYRSSGHELHLDGRDGQLLLAILLQMTMSDYPPLTSIALKVFFRHFTQYQELLE
DLKQVQLLVSNNDVENYRQIDRDLFILKNLTEKSELWVHGDRHHSIDTKEVDEKERTTEHDLLDHDLKSPRAFDSGDSME
ALMAVLNEHYPSIRNECLQLLNRLLIKDDRNDAAVALQELSDKAPLIAYPLIRQMLVRLTGMCYRKGDPKPDTMNQQLLK
NMRVYEVVLEFISVPHDKKHDHDMMKLITLSHEFLRSFCKTNKENQSRLYKFISYEKDAKEGMLRVETIEEVGTLVAIFR
NNRELASNVPEELIAHIVGLIEHNSRNPIFLELLQALVCVYDKEIESGQEKVANEICAASDEVRQLYVDNASFEELEAMM
KDEKESKGRSSDSRRKLKYHIELVRLLAMCTRGKNGNTELKCASQIPMDHIVRVVTAKQCLVEVKTVYLQLLLHCYIDTD
AEMKDAYKTEYVDHILNNLLEDIRSLRVEKLTGAETATLEHYICHTVTEVLIKFFEAPYSALQQAKVDVHHHKKTFSEVL
LELTYLEKGKLRGSKSSRNWYRVAECIKRLTKWAEEHNITLPATLAGPQMSGQTSVRQKWQQAASSAKWIGIGKRLNRQN
TLNPGHRLYGTSNSMTEHTSANVVTCYHMMIGEFKFYLHPLHAAEGSVLVEVLHTPELLFPEGSALRDQCARGGVVAKLI
QHCKTLMQNKQDNLCARVLQTLCKMCDCTKQQLTHQGQQLRQLLLQRYFGHHNNHHPPLDRQQSKIGEVIEAVKEKKEET
WSQERDLYAIQCKLNDAGASDLVTDIIIMEPSREIFLKAIHLARALLHEGNDKVQHSFYMRMKQKDIHEPFFKAILTRIQ
TAQNRLKSDMMSCSDSKPKVSLSATVSRRSSTVLTPLIDAGDTGFNGALFEVPQQVRHPSISEMSQLSNDLTHSIPDLAP
YQDEEKSTDALPPEVALVEPILRVLQLLCENHNSLLQNFLRKQSDRTNHNLVSETLSFLDTVCGSTKGSLGVFGEIGEHN
FSLITQTLATLTEFCQGPCHENQNTMAMQENGLNIIISLVLNEIKPLADDHMELALEIKSQASKLLLAIMESRHDGENAN
RVLRNMANMSGGPKQLVHAIKQAYEMTNSNHHMLKSISRDLFRQAEDDLKKKSGPQITVNTVTLPEINVDASGIVSIHTE
KNISSSLDDKFNDDDIPSVDPREVGHNIYILAHQLAIHDGELEIWLDGSDEKKDDLTREALNYYKERTAQIEIVRRDRTL
ERVVFPINDICSYLTKDTKDYVYNNTERDNQGSKVTEFFDEWETMYHEMIWQRKLQDRKWLSWCAFRLPLWTRLSFHFAF
IVNALVARYYPLPEHSNSSISLGNLYSWFAVFSSFLLAHYLRHDKIYLHKTSLLILASLCFLLLSSIGVTLTLYIFGILQ
LVNKIVHVVAFVSNKGLEDRPIAEILACRNLHYLLVYLFICILGLLVHPMIYCILLFDIIFTEETLQNVIASVTRNYQSI
VWTGLLALILLYFFSILGFLYFRHDFYLEVDPVENDSSATISSGIPSETCPSEGCPGLQPSEKDDNDDEKKVKSCETLWM
CILQTGYQGLRNGGGIGDVLRNPAPWEDMFIWRVAYDMTFFVVLIVIVLNLIFGVIIDTFGDLRAEKNEKEQILKNNCFI
CGLDRSRFDNRSVTFETHRETEHNIWHYLYYIVMLQIKDETEFTGPESYVAQCVKDRNLDWFPRMQALSLQDSELDTDQS
EVKQMKDQLLQMMTLMREIISQNEESRAFMEQFQPR
Estimated Isoelectric Point:
6.08916473388672
Estimated Molecular Weight:
324.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr145
Lys171
Gln141
Leu327
Gly116
Met82
Ser211
Tyr85
His94
Glu204
Arg152
Cys52
Phe106
Pro99
Val174
Asn156
Ala163
Ile161
Trp31
Asp166