Sequence:
download
CE37905sequence.fasta
>ITR-1, isoform a MNPSYGRVRKKVSIISIPEFVPEHYEYENETTASGGASGGGSTRIEFDFDDFEEQIMRKSSMALPSRKLTIANSIDHGNN GNLHIGDIISLYTESSSNQEQRGFLSTLGLVDDRCIVELKDGRPESPPKKFRDCLFKVCPVNRYAAQKHLWTEQKRFQTG DSMFDDDLMNKLKVAADKEREENESEFQKTLGNVIQYGSMVQLLHVKSNKYITVQKNSPAKRERNAMKVYLDRAGNEGSW FIIEPAYKHYAIGDNVSAGNKISLIPNSVSTTQAGHVKSQLHLSSFNLLDHQSAAEVNCLNEPTEWQVFMFLLFDENQQN SVKSGDVVRLFHADQQTFLTLDTIPKQNPPTDVVFLRMTNRPSAADATSSRALWEVQVVQTNAYRGGTAKWNKAYRFKHL ATDMYLSAEPSQVQVKPAMNGRRASLIYSKTNNPMAMYSDGPNGVTNESTDTTQQNIPSVWVLGPTKSEFPEEDANLLFQ LDPSTFMKSNKEVPRRSYVRLLHQSSDKWVHATNATEKQNLHYSSKNEKGWVKVICEKNRVDKETFALLPVNPDEVRDLD FANDACKALRNFIKLIKIGQVISKESINSTTQLLIDCILFVTNSSDHLADPLKISDFSPSRDRQKLLREQEVLNQVFLLL KAPFLPRQGTTELGPLLSSPSELSDSRNEIFKTMFQLCYCLLKYSQVSYRKNQEFLAEKFGEIQEQIGFDLMAEDTMTAV LHNNPKLLEKYVKTPHVERFVELVRNNRQGKFLDYLADLCVCRGEANKKIQELICTSVLSSKHRDIFMDTKIIDGEIEVG WAPNFRKLVDIAEGAKSNSDDAEHLDYYRHQLDLLSQMCQEQQYLAIDPPPERRLMNISQQLPAELVLQCMSDNRLPYDL RGSFTRLMLHLHVVRGSPMSAIRHARLWWSIPENVNVSTYESVSVEAYSDGSRMRIGEGIAHKVLATVETYLMGLRNQSM EERQSVNSSKLTYEIVNLAKALAQFNFYSFNDLLQLTQNLLAIINEGPATEQVPSHRAMVNAIRNMSKSMMRGGNKENSK DLAKTPSVTAEEAGRTKEGRALNVKTKLIVAEILQFVMDVRRDYRITMALSWFKNVFPCDEDGSLMHSASINERMASELY DAIYRSSGHELHLDGRDGQLLLAILLQMTMSDYPPLTSIALKVFFRHFTQYQELLEDLKQVQLLVSNNDVENYRQIDRDL FILKNLTEKSELWVHGDRHHSIDTKEVDEKERTTEHDLLDHDLKSPRAFDSGDSMEALMAVLNEHYPSIRNECLQLLNRL LIKDDRNDAAVALQELSDKAPLIAYPLIRQMLVRLTGMCYRKGDPKPDTMNQQLLKNMRVYEVVLEFISVPHDKKHDHDM MKLITLSHEFLRSFCKTNKENQSRLYKFISYEKDAKEGMLRVETIEEVGTLVAIFRNNRELASNVPEELIAHIVGLIEHN SRNPIFLELLQALVCVYDKEIESGQEKVANEICAASDEVRQLYVDNASFEELEAMMKDEKESKGRSSDSRRKLKYHIELV RLLAMCTRGKNGNTELKCASQIPMDHIVRVVTAKQCLVEVKTVYLQLLLHCYIDTDAEMKDAYKTEYVDHILNNLLEDIR SLRVEKLTGAETATLEHYICHTVTEVLIKFFEAPYSALQQAKVDVHHHKKTFSEVLLELTYLEKGKLRGSKSSRNWYRVA ECIKRLTKWAEEHNITLPATLAGPQMSGQTSVRQKWQQAASSAKWIGIGKRLNRQNTLNPGHRLYGTSNSMTEHTSANVV TCYHMMIGEFKFYLHPLHAAEGSVLVEVLHTPELLFPEGSALRDQCARGGVVAKLIQHCKTLMQNKQDNLCARVLQTLCK MCDCTKQQLTHQGQQLRQLLLQRYFGHHNNHHPPLDRQQSKIGEVIEAVKEKKEETWSQERDLYAIQCKLNDAGASDLVT DIIIMEPSREIFLKAIHLARALLHEGNDKVQHSFYMRMKQKDIHEPFFKAILTRIQTAQNRLKSDMMSCSDSKPKVSLSA TVSRRSSTVLTPLIDAGDTGFNGALFEVPQQVRHPSISEMSQLSNDLTHSIPDLAPYQDEEKSTDALPPEVALVEPILRV LQLLCENHNSLLQNFLRKQSDRTNHNLVSETLSFLDTVCGSTKGSLGVFGEIGEHNFSLITQTLATLTEFCQGPCHENQN TMAMQENGLNIIISLVLNEIKPLADDHMELALEIKSQASKLLLAIMESRHDGENANRVLRNMANMSGGPKQLVHAIKQAY EMTNSNHHMLKSISRDLFRQAEDDLKKKSGPQITVNTVTLPEINVDASGIVSIHTEKNISSSLDDKFNDDDIPSVDPREV GHNIYILAHQLAIHDGELEIWLDGSDEKKDDLTREALNYYKERTAQIEIVRRDRTLERVVFPINDICSYLTKDTKDYVYN NTERDNQGSKVTEFFDEWETMYHEMIWQRKLQDRKWLSWCAFRLPLWTRLSFHFAFIVNALVARYYPLPEHSNSSISLGN LYSWFAVFSSFLLAHYLRHDKIYLHKTSLLILASLCFLLLSSIGVTLTLYIFGILQLVNKIVHVVAFVSNKGLEDRPIAE ILACRNLHYLLVYLFICILGLLVHPMIYCILLFDIIFTEETLQNVIASVTRNYQSIVWTGLLALILLYFFSILGFLYFRH DFYLEVDPVENDSSATISSGIPSETCPSEGCPGLQPSEKDDNDDEKKVKSCETLWMCILQTGYQGLRNGGGIGDVLRNPA PWEDMFIWRVAYDMTFFVVLIVIVLNLIFGVIIDTFGDLRAEKNEKEQILKNNCFICGLDRSRFDNRSVTFETHRETEHN IWHYLYYIVMLQIKDETEFTGPESYVAQCVKDRNLDWFPRMQALSLQDSELDTDQSEVKQMKDQLLQMMTLMREIISQNE ESRAFMEQFQPR
view sequence (2892 aa)
>ITR-1, isoform a
MNPSYGRVRKKVSIISIPEFVPEHYEYENETTASGGASGGGSTRIEFDFDDFEEQIMRKSSMALPSRKLTIANSIDHGNN
GNLHIGDIISLYTESSSNQEQRGFLSTLGLVDDRCIVELKDGRPESPPKKFRDCLFKVCPVNRYAAQKHLWTEQKRFQTG
DSMFDDDLMNKLKVAADKEREENESEFQKTLGNVIQYGSMVQLLHVKSNKYITVQKNSPAKRERNAMKVYLDRAGNEGSW
FIIEPAYKHYAIGDNVSAGNKISLIPNSVSTTQAGHVKSQLHLSSFNLLDHQSAAEVNCLNEPTEWQVFMFLLFDENQQN
SVKSGDVVRLFHADQQTFLTLDTIPKQNPPTDVVFLRMTNRPSAADATSSRALWEVQVVQTNAYRGGTAKWNKAYRFKHL
ATDMYLSAEPSQVQVKPAMNGRRASLIYSKTNNPMAMYSDGPNGVTNESTDTTQQNIPSVWVLGPTKSEFPEEDANLLFQ
LDPSTFMKSNKEVPRRSYVRLLHQSSDKWVHATNATEKQNLHYSSKNEKGWVKVICEKNRVDKETFALLPVNPDEVRDLD
FANDACKALRNFIKLIKIGQVISKESINSTTQLLIDCILFVTNSSDHLADPLKISDFSPSRDRQKLLREQEVLNQVFLLL
KAPFLPRQGTTELGPLLSSPSELSDSRNEIFKTMFQLCYCLLKYSQVSYRKNQEFLAEKFGEIQEQIGFDLMAEDTMTAV
LHNNPKLLEKYVKTPHVERFVELVRNNRQGKFLDYLADLCVCRGEANKKIQELICTSVLSSKHRDIFMDTKIIDGEIEVG
WAPNFRKLVDIAEGAKSNSDDAEHLDYYRHQLDLLSQMCQEQQYLAIDPPPERRLMNISQQLPAELVLQCMSDNRLPYDL
RGSFTRLMLHLHVVRGSPMSAIRHARLWWSIPENVNVSTYESVSVEAYSDGSRMRIGEGIAHKVLATVETYLMGLRNQSM
EERQSVNSSKLTYEIVNLAKALAQFNFYSFNDLLQLTQNLLAIINEGPATEQVPSHRAMVNAIRNMSKSMMRGGNKENSK
DLAKTPSVTAEEAGRTKEGRALNVKTKLIVAEILQFVMDVRRDYRITMALSWFKNVFPCDEDGSLMHSASINERMASELY
DAIYRSSGHELHLDGRDGQLLLAILLQMTMSDYPPLTSIALKVFFRHFTQYQELLEDLKQVQLLVSNNDVENYRQIDRDL
FILKNLTEKSELWVHGDRHHSIDTKEVDEKERTTEHDLLDHDLKSPRAFDSGDSMEALMAVLNEHYPSIRNECLQLLNRL
LIKDDRNDAAVALQELSDKAPLIAYPLIRQMLVRLTGMCYRKGDPKPDTMNQQLLKNMRVYEVVLEFISVPHDKKHDHDM
MKLITLSHEFLRSFCKTNKENQSRLYKFISYEKDAKEGMLRVETIEEVGTLVAIFRNNRELASNVPEELIAHIVGLIEHN
SRNPIFLELLQALVCVYDKEIESGQEKVANEICAASDEVRQLYVDNASFEELEAMMKDEKESKGRSSDSRRKLKYHIELV
RLLAMCTRGKNGNTELKCASQIPMDHIVRVVTAKQCLVEVKTVYLQLLLHCYIDTDAEMKDAYKTEYVDHILNNLLEDIR
SLRVEKLTGAETATLEHYICHTVTEVLIKFFEAPYSALQQAKVDVHHHKKTFSEVLLELTYLEKGKLRGSKSSRNWYRVA
ECIKRLTKWAEEHNITLPATLAGPQMSGQTSVRQKWQQAASSAKWIGIGKRLNRQNTLNPGHRLYGTSNSMTEHTSANVV
TCYHMMIGEFKFYLHPLHAAEGSVLVEVLHTPELLFPEGSALRDQCARGGVVAKLIQHCKTLMQNKQDNLCARVLQTLCK
MCDCTKQQLTHQGQQLRQLLLQRYFGHHNNHHPPLDRQQSKIGEVIEAVKEKKEETWSQERDLYAIQCKLNDAGASDLVT
DIIIMEPSREIFLKAIHLARALLHEGNDKVQHSFYMRMKQKDIHEPFFKAILTRIQTAQNRLKSDMMSCSDSKPKVSLSA
TVSRRSSTVLTPLIDAGDTGFNGALFEVPQQVRHPSISEMSQLSNDLTHSIPDLAPYQDEEKSTDALPPEVALVEPILRV
LQLLCENHNSLLQNFLRKQSDRTNHNLVSETLSFLDTVCGSTKGSLGVFGEIGEHNFSLITQTLATLTEFCQGPCHENQN
TMAMQENGLNIIISLVLNEIKPLADDHMELALEIKSQASKLLLAIMESRHDGENANRVLRNMANMSGGPKQLVHAIKQAY
EMTNSNHHMLKSISRDLFRQAEDDLKKKSGPQITVNTVTLPEINVDASGIVSIHTEKNISSSLDDKFNDDDIPSVDPREV
GHNIYILAHQLAIHDGELEIWLDGSDEKKDDLTREALNYYKERTAQIEIVRRDRTLERVVFPINDICSYLTKDTKDYVYN
NTERDNQGSKVTEFFDEWETMYHEMIWQRKLQDRKWLSWCAFRLPLWTRLSFHFAFIVNALVARYYPLPEHSNSSISLGN
LYSWFAVFSSFLLAHYLRHDKIYLHKTSLLILASLCFLLLSSIGVTLTLYIFGILQLVNKIVHVVAFVSNKGLEDRPIAE
ILACRNLHYLLVYLFICILGLLVHPMIYCILLFDIIFTEETLQNVIASVTRNYQSIVWTGLLALILLYFFSILGFLYFRH
DFYLEVDPVENDSSATISSGIPSETCPSEGCPGLQPSEKDDNDDEKKVKSCETLWMCILQTGYQGLRNGGGIGDVLRNPA
PWEDMFIWRVAYDMTFFVVLIVIVLNLIFGVIIDTFGDLRAEKNEKEQILKNNCFICGLDRSRFDNRSVTFETHRETEHN
IWHYLYYIVMLQIKDETEFTGPESYVAQCVKDRNLDWFPRMQALSLQDSELDTDQSEVKQMKDQLLQMMTLMREIISQNE
ESRAFMEQFQPR
Estimated Isoelectric Point:
6.01290130615234
Estimated Molecular Weight:
330.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr148
Lys173
Gln142
Leu327
Gly122
Met83
Ser217
Tyr88
His95
Glu212
Arg155
Cys52
Phe110
Pro102
Val177
Asn158
Ala165
Ile166
Trp31
Asp169