Sequence:
download
CE37749sequence.fasta
>SPTL-1, isoform b MRNRSKRQQEKLSKKLTERQKDELIADWTPEPLVPETPQDHPVLNPKYADGKMTKDVSIDGEKYLNMASTNFLSFIGVKR IEDRAKQTIFKYGVGSCGPRGFYGTVDVHLDLEKELAKFMGCEEAVLYSYGFATVSSAIPAYAKKGDVIFVDEGVNFAIQ KGLQASRSRVEYFKHNDMEHLERLLLEQEQRDKKDPKKAKSVRRFIVVEGLYVNYADLCPLPKIIEFKWRFKVRVFIDES WSFGVIGKTGRGVTEHFNVPMEDVDMVMASLENALASTGGFCVGRSYVVGHQRLSGLGYCFSASLPPLLATAASEAISII DEEPSRVQKVTEMAINGQKKLQDALSGSKFSLQGCPESPMKHIYYNGEDEEKQLDTFVETVFTKNHLLLTRARYLDKDEL FKIRPSIRVMFQHDLTEEEIQRAVDAIRVVAHKF
view sequence (434 aa)
>SPTL-1, isoform b
MRNRSKRQQEKLSKKLTERQKDELIADWTPEPLVPETPQDHPVLNPKYADGKMTKDVSIDGEKYLNMASTNFLSFIGVKR
IEDRAKQTIFKYGVGSCGPRGFYGTVDVHLDLEKELAKFMGCEEAVLYSYGFATVSSAIPAYAKKGDVIFVDEGVNFAIQ
KGLQASRSRVEYFKHNDMEHLERLLLEQEQRDKKDPKKAKSVRRFIVVEGLYVNYADLCPLPKIIEFKWRFKVRVFIDES
WSFGVIGKTGRGVTEHFNVPMEDVDMVMASLENALASTGGFCVGRSYVVGHQRLSGLGYCFSASLPPLLATAASEAISII
DEEPSRVQKVTEMAINGQKKLQDALSGSKFSLQGCPESPMKHIYYNGEDEEKQLDTFVETVFTKNHLLLTRARYLDKDEL
FKIRPSIRVMFQHDLTEEEIQRAVDAIRVVAHKF
Estimated Isoelectric Point:
7.14328765869141
Estimated Molecular Weight:
49.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr18
Lys37
Gln17
Leu36
Gly28
Met11
Ser28
Tyr15
His10
Glu36
Arg25
Cys6
Phe23
Pro18
Val35
Asn12
Ala28
Ile22
Trp3
Asp26