Sequence:
download
CE37637sequence.fasta
>ACR-15 MLLPILLHFLLLITQLNGSPAEVRLINDLMSGYVREERPTLDSSKPVVVSLGVFLQQIINLSEKEEQLEVNAWLKFQWRD ENLRWEPTAYENVTDLRHPPDALWTPDILLYNSVDSEFDSSYKVNLVNYHTGNINWMPPGIFKVSCKLDIYWFPFDEQVC YFKFGSWTYTRDKIQLEKGDFDFSEFIPNGEWIIIDYRTNITVKQYECCPEQYEDITFTLHLRRRTLYYSFNLIAPVLLT MILVILGFTVSPETCEKVGLQISVSLAICIFLTIMSELTPQTSEAVPLLGVFFHTCNFISVLATSFTVYVQSFHFRNQHV HERMDFWMRFILLEWSPWLLRMKMPDRENNFQTLTESWKGRNRRESMARTAFEYADGPVTQIHSMGIMLKDNFEELIYQV KQEKIADEKGIERLRVLQKIYDHVKMIREHDDDNDEDSRVALEWRFAAIVVDRLCLLAFSLLIVVVSIIIALRAPYLFA
view sequence (479 aa)
>ACR-15
MLLPILLHFLLLITQLNGSPAEVRLINDLMSGYVREERPTLDSSKPVVVSLGVFLQQIINLSEKEEQLEVNAWLKFQWRD
ENLRWEPTAYENVTDLRHPPDALWTPDILLYNSVDSEFDSSYKVNLVNYHTGNINWMPPGIFKVSCKLDIYWFPFDEQVC
YFKFGSWTYTRDKIQLEKGDFDFSEFIPNGEWIIIDYRTNITVKQYECCPEQYEDITFTLHLRRRTLYYSFNLIAPVLLT
MILVILGFTVSPETCEKVGLQISVSLAICIFLTIMSELTPQTSEAVPLLGVFFHTCNFISVLATSFTVYVQSFHFRNQHV
HERMDFWMRFILLEWSPWLLRMKMPDRENNFQTLTESWKGRNRRESMARTAFEYADGPVTQIHSMGIMLKDNFEELIYQV
KQEKIADEKGIERLRVLQKIYDHVKMIREHDDDNDEDSRVALEWRFAAIVVDRLCLLAFSLLIVVVSIIIALRAPYLFA
Estimated Isoelectric Point:
5.18083953857422
Estimated Molecular Weight:
56.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr26
Lys19
Gln18
Leu56
Gly15
Met13
Ser29
Tyr18
His11
Glu36
Arg27
Cys8
Phe30
Pro21
Val35
Asn21
Ala19
Ile37
Trp13
Asp27