Sequence:
download
CE37330sequence.fasta
>ACR-9 MISPVLRLTALHCVLFHLLTEVHSSADEYRLLADLRHNYDPYERPVANASEPLVVSVKIYLQQILDVDEKNQVITLVAWI EYQWTDYKLKWDPSEYGGIKDIRIPGNANAIWKPDVLLYNSADENFDSTYPVNYVVSYTGDVLQVPPGILKLSCKIDITY FPFDDQICHLKFGSWTYSGNFIDLRINGPEGKNISDEGIDVQYYVQNGEWNLLAVPARHETNIFDEQPYPSLFFYLIIQR RTLYYGLNLIIPSFLISLMTVLGFTLPPDAGEKITLEITILLSVCFFLSMVADMTPPTSEAVPLIGAFFSCCMLVVSASV VFTVLVLNLHNRKPETHEMSPFLRELLLIWLPWLLLMRRPGKTIFNCTHLKAEKAEEKAKQGSIKNGVGPGKPTDSVHPS EGLSLMKNIKLGRQQTIDFEYEFHVQHNHLMPVAPSEMTPRVTYSKVMAESYVEDVVMTELNKYMQKACLELKNISSQTR AMRKKMEEDERDEQAANDWKFAAMVVDRCCLITFSVFIVVSTCGIMFSSPHLIA
view sequence (534 aa)
>ACR-9
MISPVLRLTALHCVLFHLLTEVHSSADEYRLLADLRHNYDPYERPVANASEPLVVSVKIYLQQILDVDEKNQVITLVAWI
EYQWTDYKLKWDPSEYGGIKDIRIPGNANAIWKPDVLLYNSADENFDSTYPVNYVVSYTGDVLQVPPGILKLSCKIDITY
FPFDDQICHLKFGSWTYSGNFIDLRINGPEGKNISDEGIDVQYYVQNGEWNLLAVPARHETNIFDEQPYPSLFFYLIIQR
RTLYYGLNLIIPSFLISLMTVLGFTLPPDAGEKITLEITILLSVCFFLSMVADMTPPTSEAVPLIGAFFSCCMLVVSASV
VFTVLVLNLHNRKPETHEMSPFLRELLLIWLPWLLLMRRPGKTIFNCTHLKAEKAEEKAKQGSIKNGVGPGKPTDSVHPS
EGLSLMKNIKLGRQQTIDFEYEFHVQHNHLMPVAPSEMTPRVTYSKVMAESYVEDVVMTELNKYMQKACLELKNISSQTR
AMRKKMEEDERDEQAANDWKFAAMVVDRCCLITFSVFIVVSTCGIMFSSPHLIA
Estimated Isoelectric Point:
5.44680023193359
Estimated Molecular Weight:
60.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr28
Lys28
Gln17
Leu59
Gly23
Met17
Ser36
Tyr23
His14
Glu34
Arg19
Cys11
Phe24
Pro32
Val43
Asn24
Ala28
Ile37
Trp9
Asp28