Sequence:
download
CE37237sequence.fasta
>LIN-42, isoform b MEPAGHSSATHNIVVPNANPTQPQPLAPAMREEGATLSPPNTWSSSSVEFLDDADDNRLLFTCTFTLPHGTVLSSATYAD GFHEQYLTIGDNFLARLEPKGQSFILSAAAASVKQRIFARVTMPDGALRACELLCEFETDRAKITVLALRSAFSLQASHV SSNFHVFTFITKHSSTCALTHIDYASIPYLGLLPTDLIGKSLLAFVYSPDVHVVRQAHIDLHNSRGKIVKSIADLRLVAH NGSILRCQTEWSAYVNPWTRKMELVVARHRICSLPIGDSDVISSPPPGIQSNTLPPVMAKTFEDELRTIMNKPVPSTSRH SHHHHHSSLKDQNQGFPANIDLGAYIDKIVEQLVVNSTAQQQQKVAVAAAAAAQAAQAAVVATAQIRKVASAPPTTSTDP PLSYTQINCLENVHRLLKSQSRPESPAKQDEPFDEKKYPPQTPLTREALTLHTKRFEDEYKDTWCRRLKRLSDDVPSSPP AKRTTPIHWTSSSQNHYRTMAPAPPPPPGKNYQITYTPLDDLTDQKSTNTKSDVENVAYPISGSKFSTPMRLSIDGLLPR GATSTGGASPTSGTNSPPVFPKTSSSSSLLMLRDSQN
view sequence (597 aa)
>LIN-42, isoform b
MEPAGHSSATHNIVVPNANPTQPQPLAPAMREEGATLSPPNTWSSSSVEFLDDADDNRLLFTCTFTLPHGTVLSSATYAD
GFHEQYLTIGDNFLARLEPKGQSFILSAAAASVKQRIFARVTMPDGALRACELLCEFETDRAKITVLALRSAFSLQASHV
SSNFHVFTFITKHSSTCALTHIDYASIPYLGLLPTDLIGKSLLAFVYSPDVHVVRQAHIDLHNSRGKIVKSIADLRLVAH
NGSILRCQTEWSAYVNPWTRKMELVVARHRICSLPIGDSDVISSPPPGIQSNTLPPVMAKTFEDELRTIMNKPVPSTSRH
SHHHHHSSLKDQNQGFPANIDLGAYIDKIVEQLVVNSTAQQQQKVAVAAAAAAQAAQAAVVATAQIRKVASAPPTTSTDP
PLSYTQINCLENVHRLLKSQSRPESPAKQDEPFDEKKYPPQTPLTREALTLHTKRFEDEYKDTWCRRLKRLSDDVPSSPP
AKRTTPIHWTSSSQNHYRTMAPAPPPPPGKNYQITYTPLDDLTDQKSTNTKSDVENVAYPISGSKFSTPMRLSIDGLLPR
GATSTGGASPTSGTNSPPVFPKTSSSSSLLMLRDSQN
Estimated Isoelectric Point:
8.30496978759766
Estimated Molecular Weight:
65.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr50
Lys27
Gln27
Leu52
Gly22
Met9
Ser65
Tyr14
His23
Glu22
Arg30
Cys8
Phe19
Pro52
Val34
Asn23
Ala56
Ile27
Trp5
Asp32