Sequence:
download
CE37161sequence.fasta
>LIT-1, isoform e MALVSHTHPAAVGSTTCYEKNQQKQQQVQQIPTQPQVAHVSSNAILAAAQPFYPPPVQDSQPDRPIGYGAFGVVWSVTDP RSGKRVALKKMPNVFQNLASCKRVFREIKMLSSFRHDNVLSLLDILQPANPSFFQELYVLTELMQSDLHKIIVSPQALTP DHVKVFVYQILRGLKYLHTANILHRDIKPGNLLVNSNCILKICDFGLARTWDQRDRLNMTHEVVTQYYRAPELLMGARRY TGAVDIWSVGCIFAELLQRKILFQAAGPIEQLQMIIDLLGTPSQEAMKYACEGAKNHVLRAGLRAPDTQRLYKIASPDDK NHEAVDLLQKLLHFDPDKRISVEEALQHRYLEEGRLRFHSCMCSCCYTKPNMPSRLFAQDLDPRHESPFDPKWEKDMSRL SMFELREKMYQFVMDRPALYGVALCINPQSAAYKNFASSSVAQASELPPSPQAW
view sequence (454 aa)
>LIT-1, isoform e
MALVSHTHPAAVGSTTCYEKNQQKQQQVQQIPTQPQVAHVSSNAILAAAQPFYPPPVQDSQPDRPIGYGAFGVVWSVTDP
RSGKRVALKKMPNVFQNLASCKRVFREIKMLSSFRHDNVLSLLDILQPANPSFFQELYVLTELMQSDLHKIIVSPQALTP
DHVKVFVYQILRGLKYLHTANILHRDIKPGNLLVNSNCILKICDFGLARTWDQRDRLNMTHEVVTQYYRAPELLMGARRY
TGAVDIWSVGCIFAELLQRKILFQAAGPIEQLQMIIDLLGTPSQEAMKYACEGAKNHVLRAGLRAPDTQRLYKIASPDDK
NHEAVDLLQKLLHFDPDKRISVEEALQHRYLEEGRLRFHSCMCSCCYTKPNMPSRLFAQDLDPRHESPFDPKWEKDMSRL
SMFELREKMYQFVMDRPALYGVALCINPQSAAYKNFASSSVAQASELPPSPQAW
Estimated Isoelectric Point:
8.74439239501953
Estimated Molecular Weight:
51.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr15
Lys24
Gln33
Leu48
Gly17
Met14
Ser31
Tyr16
His15
Glu20
Arg27
Cys11
Phe18
Pro32
Val29
Asn16
Ala38
Ile21
Trp5
Asp24