Sequence:
download
CE37160sequence.fasta
>LIT-1, isoform d MGRNQEGQFNGAGNSESAGSSSSSGCSSSSTELYDLAAAHAALISRQQQILSQAIPIIPEHQLAAVAAHHQHHQQLHPSV QYQLVAAATHHNHHQPQAAQPHYSAVVPRSDVIQQPPHFALHHHLQNLVQQQQQQQAHHHHQQLVGEMALVSHTHPAAVG STTCYEKNQQKQQQVQQIPTQPQVAHVSSNAILAAAQPFYPPPVQDSQPDRPIGYGAFGVVWSVTDPRSGKRVALKKMPN VFQNLASCKRVFREIKMLSSFRHDNVLSLLDILQPANPSFFQELYVLTELMQSDLHKIIVSPQALTPDHVKVFVYQILRG LKYLHTANILHRDIKPGNLLVNSNCILKICDFGLARTWDQRDRLNMTHEVVTQYYRAPELLMGARRYTGAVDIWSVGCIF AELLQRKILFQAAGPIEQLQMIIDLLGTPSQEAMKYACEGAKNHVLRAGLRAPDTQRLYKIASPDDKNHEAVDLLQKLLH FDPDKRISVEEALQHRYLEEGRLRFHSCMCSCCYTKPNMPSRLFAQDLDPRHESPFDPKWEKDMSRLSMFELREKMYQFV MDRPALYGVALCINPQSAAYKNFASSSVAQASELPPSPQAW
view sequence (601 aa)
>LIT-1, isoform d
MGRNQEGQFNGAGNSESAGSSSSSGCSSSSTELYDLAAAHAALISRQQQILSQAIPIIPEHQLAAVAAHHQHHQQLHPSV
QYQLVAAATHHNHHQPQAAQPHYSAVVPRSDVIQQPPHFALHHHLQNLVQQQQQQQAHHHHQQLVGEMALVSHTHPAAVG
STTCYEKNQQKQQQVQQIPTQPQVAHVSSNAILAAAQPFYPPPVQDSQPDRPIGYGAFGVVWSVTDPRSGKRVALKKMPN
VFQNLASCKRVFREIKMLSSFRHDNVLSLLDILQPANPSFFQELYVLTELMQSDLHKIIVSPQALTPDHVKVFVYQILRG
LKYLHTANILHRDIKPGNLLVNSNCILKICDFGLARTWDQRDRLNMTHEVVTQYYRAPELLMGARRYTGAVDIWSVGCIF
AELLQRKILFQAAGPIEQLQMIIDLLGTPSQEAMKYACEGAKNHVLRAGLRAPDTQRLYKIASPDDKNHEAVDLLQKLLH
FDPDKRISVEEALQHRYLEEGRLRFHSCMCSCCYTKPNMPSRLFAQDLDPRHESPFDPKWEKDMSRLSMFELREKMYQFV
MDRPALYGVALCINPQSAAYKNFASSSVAQASELPPSPQAW
Estimated Isoelectric Point:
8.19217681884766
Estimated Molecular Weight:
67.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr17
Lys24
Gln60
Leu59
Gly24
Met15
Ser47
Tyr19
His35
Glu25
Arg30
Cys12
Phe20
Pro40
Val37
Asn21
Ala58
Ile27
Trp5
Asp26