Sequence:
download
CE37112sequence.fasta
>F46H5.3, isoform a MLHRCSRVLSQFLGRGNSKMLREAYSTSLHCVQAQEGMSVSPDVIAKIEEGYAKLQAAPECHSLLKKYLTKEVVDQLKDK KTKLGANLLDVIQSGVANLDSGVGVYAPDAEAYTLFKPLFDPLIQDYHNGFAPDAKQPNTDLGEGKTSALVDLDPEGKFI NSTRIRCGRSLQGYPFNPCLSEANYLEMESKVKAIFDNITDPELAGKYFPLDGMTKEIQDQLIKDHFLFKEGDRFLQAAN ACRYWPKGRGIFHNNQKTFLIWCNEEDHLRIISMQEGGNVGQVLERLIKGVKTIEKQAPFSRDDRLGWLTFCPSNLGTTV RASVHIRLPKISAKPDFKSICDGLKLQIRGIHGEHSESEGGVYDISNKARLGLTEFEAVKQMYDGIAHLIALEKAA
view sequence (396 aa)
>F46H5.3, isoform a
MLHRCSRVLSQFLGRGNSKMLREAYSTSLHCVQAQEGMSVSPDVIAKIEEGYAKLQAAPECHSLLKKYLTKEVVDQLKDK
KTKLGANLLDVIQSGVANLDSGVGVYAPDAEAYTLFKPLFDPLIQDYHNGFAPDAKQPNTDLGEGKTSALVDLDPEGKFI
NSTRIRCGRSLQGYPFNPCLSEANYLEMESKVKAIFDNITDPELAGKYFPLDGMTKEIQDQLIKDHFLFKEGDRFLQAAN
ACRYWPKGRGIFHNNQKTFLIWCNEEDHLRIISMQEGGNVGQVLERLIKGVKTIEKQAPFSRDDRLGWLTFCPSNLGTTV
RASVHIRLPKISAKPDFKSICDGLKLQIRGIHGEHSESEGGVYDISNKARLGLTEFEAVKQMYDGIAHLIALEKAA
Estimated Isoelectric Point:
6.83460235595703
Estimated Molecular Weight:
44.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr15
Lys32
Gln18
Leu42
Gly32
Met7
Ser24
Tyr12
His11
Glu26
Arg18
Cys9
Phe17
Pro17
Val19
Asn16
Ala29
Ile24
Trp3
Asp25