Sequence:
download
CE36940sequence.fasta
>MYRF-1 MSSSDLLKGEFDGLNSEHFNMMQYLTQDTDEDDGSMVSPTSSADSMHQNLGVQQQQQQMLQAQQRQNQNGIFQPRRFPES PAMTDPCGNVSSSSSSSHHSDPMFSPNEFNGYAGANDNGNQTMNNIQSQQLSQQQHQQTRGGNLMMPQQSSIHAQMQNMN APQFWSQPGTAAVNQPTNTLAQLNLFNIIRGGADSGMPSPVLEMPRKRSRLDTPCETPRIAPSFAGIDGFPDENYSQQQA IRFSKFQEEQWSPLYDINAQPLQQLQVHVVADKGFNYNSNDNCFVNQKKNHFQISVNVEASDTMPPKYVNFNNRLVPIRD FKLSFCGVKAEMPSSEITIRQSRADRKPHTHTPVLFEIQERRMTKVCVPRLHFSETTLNNQRKQKNRPNPEQKFFLLVVR LFASIDESEHGVLIQSYASEKVIVRATNPGSFEPQDTDIGWQRNGGALYTQGAVSVGTEHQVESAKLTVAGDIYMSGRII NPSDIRLKEAITERETAEAIENLLKLRVVDYRYKPEVADIWGLDEQQRHRTGLIAQELQAVLPDAVRDIGDYLTIDEGRV FYETVMATQQLCRMTGDLDSKIDEKVAEISRRLNEYAVRKKLASSMASNLNGDNKSLSYSRCSLTSTATNATSQPKRSRK HRAIKQAQSCGSRLSQGTVVTLVSIMAACLLAMSALYVLDWHNRNYGYHQHFETNTPSTKGELANLVISPANFMPSFQPD APILLEKCFNPSCKTYCCTDTPPVVEDSRAIATHGLDNGDEVYPESPSNRTNGIARAPNLEHMAFETGVEIRIPALNVTL DQRYCVERSCNKRKGIFNVFVPVSRYMPDVALEIEIKAPISKVVSNCGAFPSTEFNHKVCPLSRTQQSESPVPTSTRLFD NIFELSMGSFIQSAYRFRVGYSTETCFSEDSNGSYEEYNLIFYRMCTLSSS
view sequence (931 aa)
>MYRF-1
MSSSDLLKGEFDGLNSEHFNMMQYLTQDTDEDDGSMVSPTSSADSMHQNLGVQQQQQQMLQAQQRQNQNGIFQPRRFPES
PAMTDPCGNVSSSSSSSHHSDPMFSPNEFNGYAGANDNGNQTMNNIQSQQLSQQQHQQTRGGNLMMPQQSSIHAQMQNMN
APQFWSQPGTAAVNQPTNTLAQLNLFNIIRGGADSGMPSPVLEMPRKRSRLDTPCETPRIAPSFAGIDGFPDENYSQQQA
IRFSKFQEEQWSPLYDINAQPLQQLQVHVVADKGFNYNSNDNCFVNQKKNHFQISVNVEASDTMPPKYVNFNNRLVPIRD
FKLSFCGVKAEMPSSEITIRQSRADRKPHTHTPVLFEIQERRMTKVCVPRLHFSETTLNNQRKQKNRPNPEQKFFLLVVR
LFASIDESEHGVLIQSYASEKVIVRATNPGSFEPQDTDIGWQRNGGALYTQGAVSVGTEHQVESAKLTVAGDIYMSGRII
NPSDIRLKEAITERETAEAIENLLKLRVVDYRYKPEVADIWGLDEQQRHRTGLIAQELQAVLPDAVRDIGDYLTIDEGRV
FYETVMATQQLCRMTGDLDSKIDEKVAEISRRLNEYAVRKKLASSMASNLNGDNKSLSYSRCSLTSTATNATSQPKRSRK
HRAIKQAQSCGSRLSQGTVVTLVSIMAACLLAMSALYVLDWHNRNYGYHQHFETNTPSTKGELANLVISPANFMPSFQPD
APILLEKCFNPSCKTYCCTDTPPVVEDSRAIATHGLDNGDEVYPESPSNRTNGIARAPNLEHMAFETGVEIRIPALNVTL
DQRYCVERSCNKRKGIFNVFVPVSRYMPDVALEIEIKAPISKVVSNCGAFPSTEFNHKVCPLSRTQQSESPVPTSTRLFD
NIFELSMGSFIQSAYRFRVGYSTETCFSEDSNGSYEEYNLIFYRMCTLSSS
Estimated Isoelectric Point:
6.07047271728516
Estimated Molecular Weight:
104.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr53
Lys35
Gln69
Leu63
Gly47
Met29
Ser91
Tyr27
His21
Glu55
Arg55
Cys19
Phe40
Pro54
Val55
Asn63
Ala59
Ile45
Trp5
Asp46