Sequence:
download
CE36545sequence.fasta
>CUL-4 MTSGAPPTISTEKSRSKQLRKSSKRTASTVEGTEAKQMRGDTENRSDGEMDDVSTSSEIRHGNGFIENFRSQTGNSSRTT ATNERIKKKLVIKNFKANANQNDVAMGDTNIDSTDGSVGRDWAVLSDNVFAILEDRKTVTTLEGLFSKVRSVCDKNQSKV LYDRLVAIVVQFAKSLKESLNAVEQVPLAEDNCEQYLEKFGQIWQAYPVKINLIRNIFLHLDRIALGATDTEILPLWECF MQIFQKTFFPNIFKEFKATKLFNALYMAMQKIMQRYPVDSPLRSLVDMLQTVHVSEEFAKFLISQLREHYNNERIDKVPK MNCNDYMEYCEDQINRYSQLVKVNFDEPSALKDVQATVTNCLIQQAIPEILTHDFDDLIDSDNISDIGRMFNLCRQCVGG EDEVRTQFSKYLKKRGEKLIATCPDEDLVSELLAFKKKVDFIMTGSFKSANDPVKMRQCLSDAFESFVNKQVDRSAELIS KHFHTLLHSSNKNVSDDTTLDQMVDEAIVLFRYLRGKDVFEAYYKRGLAKRLFLERSASVDAEKMVLCKLKTECGSAFTY KLEGMFKDMDASENYGRLFNQYLEHMNKEKANFTARVITPEYWPTYDTYEINIPKEMRDTLTDYQDFYRVQHGNRNVKWH HGLASAVISASFRPGCKKELIATMYQTVILLLFNKCETWTVAEIVEHTKILEIEVVKNVLALLGGRDKPKVLQRVEGGGS EKKEGTVENLKNEKFVVNSKFTEKRCRVRIAQVNIKTAVEETKEVKEEVNSDRQYKIDAAVVRIMKARKQLNHQTLMTEL LQQLRFPVSTADIKKRLESLIEREYISRDPEEASSYNYVA
view sequence (840 aa)
>CUL-4
MTSGAPPTISTEKSRSKQLRKSSKRTASTVEGTEAKQMRGDTENRSDGEMDDVSTSSEIRHGNGFIENFRSQTGNSSRTT
ATNERIKKKLVIKNFKANANQNDVAMGDTNIDSTDGSVGRDWAVLSDNVFAILEDRKTVTTLEGLFSKVRSVCDKNQSKV
LYDRLVAIVVQFAKSLKESLNAVEQVPLAEDNCEQYLEKFGQIWQAYPVKINLIRNIFLHLDRIALGATDTEILPLWECF
MQIFQKTFFPNIFKEFKATKLFNALYMAMQKIMQRYPVDSPLRSLVDMLQTVHVSEEFAKFLISQLREHYNNERIDKVPK
MNCNDYMEYCEDQINRYSQLVKVNFDEPSALKDVQATVTNCLIQQAIPEILTHDFDDLIDSDNISDIGRMFNLCRQCVGG
EDEVRTQFSKYLKKRGEKLIATCPDEDLVSELLAFKKKVDFIMTGSFKSANDPVKMRQCLSDAFESFVNKQVDRSAELIS
KHFHTLLHSSNKNVSDDTTLDQMVDEAIVLFRYLRGKDVFEAYYKRGLAKRLFLERSASVDAEKMVLCKLKTECGSAFTY
KLEGMFKDMDASENYGRLFNQYLEHMNKEKANFTARVITPEYWPTYDTYEINIPKEMRDTLTDYQDFYRVQHGNRNVKWH
HGLASAVISASFRPGCKKELIATMYQTVILLLFNKCETWTVAEIVEHTKILEIEVVKNVLALLGGRDKPKVLQRVEGGGS
EKKEGTVENLKNEKFVVNSKFTEKRCRVRIAQVNIKTAVEETKEVKEEVNSDRQYKIDAAVVRIMKARKQLNHQTLMTEL
LQQLRFPVSTADIKKRLESLIEREYISRDPEEASSYNYVA
Estimated Isoelectric Point:
7.48668670654297
Estimated Molecular Weight:
96.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr51
Lys73
Gln37
Leu70
Gly32
Met23
Ser56
Tyr26
His14
Glu68
Arg49
Cys15
Phe40
Pro20
Val63
Asn47
Ala51
Ile46
Trp6
Asp53