Sequence:
download
CE36334sequence.fasta
>LEV-10, isoform b MHLIYLFLLSIFVSKADGNSRKTIFQCDQHFDESQPEGVIEFPSLPKQLALSHGVNNSKPEQQYNLQCVYTFVAGSRQRV RLEFDHFLLSGSSENCDIEYVDIYSEVESVDEDILSSALGGRYCGTVAPHVRISLRRVMKLVLHSRSTNHEDNHGFRAKY SFIPEDKFIAGEPVGGKKCSFIIDSSDRKIGTLYSPTYPGTYPHNMHCSYLMKAGRGERIRLFFTDFDIFFGGEHCPYDS VTIFDGPTPASPIIRKVCGLQQRMEVYSMGNSLLIHFNTTHPAKSDPRGFIMDYEFSTRFVNIDKLLNKQRGVTHIRGTE CDVRVESNRETFHTISSPNYPEVYPANTTCTYIIHGLQGEQNLEKVILTFDSIAVLSFDTSPATAPPSADIDDIACPSAW VGIAIGEGNMKAVMSSTDDSTFDVTLCERIPPNSPLLGPYISEGPRMVMQFGSTETRDDNISPIGFKATIEFKTDFGVTG ESLGTSNECKFRFTSSTGFFNSPRYPANYPLDTNCTYYIVGQPGKEILLHFEQFALSGNTDNNCNDYLDVYDVFVKNGKE ELRRKERYCADTFPGPSVSAFGSHEMRVVFTSGSSGTANGFKALFEIRTARKEDVPRGEAHIRRGAYRCGSVINSTSEKP NGLIISPNYPVKYNKDVHCDWQINVKEGYQVLLKMEAIDVEGEMTSNGASCQKAVIRVDGGPRSEYCGTKREFFEAYLSP SNSVRISFLTAPDKVNGLKGFNLSWTEVKNLSGKDENVCKSDSLYLCTYSKLCIDAKLRCNGLDNCGYGVQDDTDEQHCQ NYSPRTFYTAKFMATSSSATVALTILIIVMLVLPAILCAH
view sequence (840 aa)
>LEV-10, isoform b
MHLIYLFLLSIFVSKADGNSRKTIFQCDQHFDESQPEGVIEFPSLPKQLALSHGVNNSKPEQQYNLQCVYTFVAGSRQRV
RLEFDHFLLSGSSENCDIEYVDIYSEVESVDEDILSSALGGRYCGTVAPHVRISLRRVMKLVLHSRSTNHEDNHGFRAKY
SFIPEDKFIAGEPVGGKKCSFIIDSSDRKIGTLYSPTYPGTYPHNMHCSYLMKAGRGERIRLFFTDFDIFFGGEHCPYDS
VTIFDGPTPASPIIRKVCGLQQRMEVYSMGNSLLIHFNTTHPAKSDPRGFIMDYEFSTRFVNIDKLLNKQRGVTHIRGTE
CDVRVESNRETFHTISSPNYPEVYPANTTCTYIIHGLQGEQNLEKVILTFDSIAVLSFDTSPATAPPSADIDDIACPSAW
VGIAIGEGNMKAVMSSTDDSTFDVTLCERIPPNSPLLGPYISEGPRMVMQFGSTETRDDNISPIGFKATIEFKTDFGVTG
ESLGTSNECKFRFTSSTGFFNSPRYPANYPLDTNCTYYIVGQPGKEILLHFEQFALSGNTDNNCNDYLDVYDVFVKNGKE
ELRRKERYCADTFPGPSVSAFGSHEMRVVFTSGSSGTANGFKALFEIRTARKEDVPRGEAHIRRGAYRCGSVINSTSEKP
NGLIISPNYPVKYNKDVHCDWQINVKEGYQVLLKMEAIDVEGEMTSNGASCQKAVIRVDGGPRSEYCGTKREFFEAYLSP
SNSVRISFLTAPDKVNGLKGFNLSWTEVKNLSGKDENVCKSDSLYLCTYSKLCIDAKLRCNGLDNCGYGVQDDTDEQHCQ
NYSPRTFYTAKFMATSSSATVALTILIIVMLVLPAILCAH
Estimated Isoelectric Point:
5.80963897705078
Estimated Molecular Weight:
93.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr53
Lys41
Gln22
Leu57
Gly62
Met16
Ser77
Tyr36
His22
Glu50
Arg43
Cys27
Phe48
Pro44
Val53
Asn43
Ala41
Ile52
Trp3
Asp50