Sequence:
download
CE36322sequence.fasta
>SRX-43 MVLRNLTAMAIYDQTFVYSSDDALAGMVVSMECLTGLFLLVAVIIGCFRIAALKSPFGILMINQNCAQLMACINSGSFST LGVLLNIKPVLSISYLFGNFSIFLLPVILISFLLMSFNRFCACFFPLRYQNLFSSSMIRTFIVFNWLLSLVAGSYLVVVR ECNFVFYHFGWLFAGSVSVKCGTLLSLYSISIQTVLSITIVGLDVVTLVALMAFRSKVYQSHSVEVRRRELSFSGQVIIQ GAVFLCHGAWYDMGHAILPGNDDRWKFFFTTSFSSNLLHVFDPVVVFAFNKEFRRWLFRNFNVPTAQKRIVTVVSAHNT
view sequence (319 aa)
>SRX-43
MVLRNLTAMAIYDQTFVYSSDDALAGMVVSMECLTGLFLLVAVIIGCFRIAALKSPFGILMINQNCAQLMACINSGSFST
LGVLLNIKPVLSISYLFGNFSIFLLPVILISFLLMSFNRFCACFFPLRYQNLFSSSMIRTFIVFNWLLSLVAGSYLVVVR
ECNFVFYHFGWLFAGSVSVKCGTLLSLYSISIQTVLSITIVGLDVVTLVALMAFRSKVYQSHSVEVRRRELSFSGQVIIQ
GAVFLCHGAWYDMGHAILPGNDDRWKFFFTTSFSSNLLHVFDPVVVFAFNKEFRRWLFRNFNVPTAQKRIVTVVSAHNT
Estimated Isoelectric Point:
9.22963714599609
Estimated Molecular Weight:
35.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys7
Gln9
Leu40
Gly17
Met10
Ser32
Tyr9
His6
Glu5
Arg15
Cys9
Phe33
Pro7
Val35
Asn16
Ala20
Ile22
Trp5
Asp8