Sequence:
download
CE35647sequence.fasta
>RAD-54.B, isoform a MSRVVLNVDSYEGNDTPSAEIARFVVLYGKASTRKHKIWEGDGLLVCFTDSCLLKSEDERDVICRSSALKGLDQLEDGRI INIGSWSVEIQERIATGPPQKPISAQKPEIQSPMPPMTPGNSENVENRKRGGFSSPFLGIELPKPLSKRSATFVPPLIGS ESSSSGGSSSSTIQEKIPPFILNEQDILDRKTTSAVTVDTRFARHLRPHQKSGIQFIFDRLRRGSGKNGGGGGAILADDM GLGKSLQTMAATWALLKGSKTAQQLANSCLIIVPSSLVNNWKAEFDKWWRLMRFPAVIALTANDITTYQSTIKLMPYLVI SYDLAQRHVEKLKIIRFDVMVCDEGHKLKNLDGKLRKTLLSLEIPRRLILTGTPMQNDFEEFYSLLDFVRPSVFGSIVEF RKMCSDRPEQLNELIDECMLRRTAADVDLKHLPEKHEYILFCAASPIQKHVHSEICDYMTGDALSLIFFARQLANHPKLL LDNLREKTEKSKAHKHSPLLLAFDGAHMPRGGVKESGKLTALVDMIKCFRLLQECTVIVSNYIETLDMIQQLCEYLNFKV LRLDGKTQVPDRQKLVRTFNDHRDPSNIFLLSTKAGGVGLNLIGASRLVLFDSDWNPANDQQAMARIWRDGQVRPCHIYR LITTGTIEEKMLQRQIKKTGLGCVIDAIEVGDTIATFTDEDLKDIFTFTGSATECNTHDLCECPCDGCGMLENEMDEEDD GDDVVENDAEKIDKSGKIDKIDSDDDEEADDEELEADVTDEVVEDSQEPPEATKPAVAAAGLRTIASLAELSRWRHFSPR HADTWHHFMTNAGLSQVDTDVELTFAFYQESQY
view sequence (833 aa)
>RAD-54.B, isoform a
MSRVVLNVDSYEGNDTPSAEIARFVVLYGKASTRKHKIWEGDGLLVCFTDSCLLKSEDERDVICRSSALKGLDQLEDGRI
INIGSWSVEIQERIATGPPQKPISAQKPEIQSPMPPMTPGNSENVENRKRGGFSSPFLGIELPKPLSKRSATFVPPLIGS
ESSSSGGSSSSTIQEKIPPFILNEQDILDRKTTSAVTVDTRFARHLRPHQKSGIQFIFDRLRRGSGKNGGGGGAILADDM
GLGKSLQTMAATWALLKGSKTAQQLANSCLIIVPSSLVNNWKAEFDKWWRLMRFPAVIALTANDITTYQSTIKLMPYLVI
SYDLAQRHVEKLKIIRFDVMVCDEGHKLKNLDGKLRKTLLSLEIPRRLILTGTPMQNDFEEFYSLLDFVRPSVFGSIVEF
RKMCSDRPEQLNELIDECMLRRTAADVDLKHLPEKHEYILFCAASPIQKHVHSEICDYMTGDALSLIFFARQLANHPKLL
LDNLREKTEKSKAHKHSPLLLAFDGAHMPRGGVKESGKLTALVDMIKCFRLLQECTVIVSNYIETLDMIQQLCEYLNFKV
LRLDGKTQVPDRQKLVRTFNDHRDPSNIFLLSTKAGGVGLNLIGASRLVLFDSDWNPANDQQAMARIWRDGQVRPCHIYR
LITTGTIEEKMLQRQIKKTGLGCVIDAIEVGDTIATFTDEDLKDIFTFTGSATECNTHDLCECPCDGCGMLENEMDEEDD
GDDVVENDAEKIDKSGKIDKIDSDDDEEADDEELEADVTDEVVEDSQEPPEATKPAVAAAGLRTIASLAELSRWRHFSPR
HADTWHHFMTNAGLSQVDTDVELTFAFYQESQY
Estimated Isoelectric Point:
5.30976104736328
Estimated Molecular Weight:
93.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr48
Lys51
Gln32
Leu85
Gly52
Met20
Ser61
Tyr13
His20
Glu58
Arg47
Cys19
Phe33
Pro38
Val44
Asn28
Ala53
Ile54
Trp10
Asp67