Sequence:
download
CE35596sequence.fasta
>R07B7.10 MYADFIAGWAAGGAGLLVGHPLDTVKARLQTMNIYKGIVDCMVKTMKQESVYGLYKGMFVPFISTGALHSLLFAGYGAGL KFLNPGDSNVMARKDLPMSDILIASICGTLVQVGPVIPVELLKTKLQVQRENIGHFSKHSRNLYAGPLECARETVRAEGV RGLFKGGSVVFCRDNIGYLFYIPVYEGLSRYFRSHNLENTWTQLFAGGCAGVSGWISVCPLEVVKNRIQADKSHKTLSPK EMTLKIYREDGLRAFYRGGWAISLRGFVVNAVIFVVYENTYSFFD
view sequence (285 aa)
>R07B7.10
MYADFIAGWAAGGAGLLVGHPLDTVKARLQTMNIYKGIVDCMVKTMKQESVYGLYKGMFVPFISTGALHSLLFAGYGAGL
KFLNPGDSNVMARKDLPMSDILIASICGTLVQVGPVIPVELLKTKLQVQRENIGHFSKHSRNLYAGPLECARETVRAEGV
RGLFKGGSVVFCRDNIGYLFYIPVYEGLSRYFRSHNLENTWTQLFAGGCAGVSGWISVCPLEVVKNRIQADKSHKTLSPK
EMTLKIYREDGLRAFYRGGWAISLRGFVVNAVIFVVYENTYSFFD
Estimated Isoelectric Point:
9.21746063232422
Estimated Molecular Weight:
31.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr12
Lys16
Gln7
Leu28
Gly31
Met8
Ser17
Tyr14
His6
Glu12
Arg15
Cys6
Phe16
Pro10
Val26
Asn11
Ala20
Ile16
Trp4
Asp10