Sequence:
download
CE35482sequence.fasta
>NHR-176 MTKKSTIQPCLVCGQSSNSILFGAPSCRACGEFFRRKVISNFKIKNNCLGECSFAKKSMKPCQSCRFQKCLEAGMLEKMV FSRKAIYSISNFEKSILEELEEAYSKLEHGRNETFNPKSDSNPKFCSHEELNNTCTIDIQIILDNLISYFQAKKPMGKEQ DDVLKMHFIVPFVLFDTAFRAIGKSSYISPDGTMFGGSYVEKLYQDSSNSKIGVNNGKTSREIMESYWKVSYKILKSEME LLQLDRSEFLLLSALIYWDFGLENQSDKCCENCNTIREKVLKELVKYERKKSGQNALRIAMIMGLLQAVPKALDVMKTCG FLSKIYNLRGSGCPLYAISTNSPPQ
view sequence (345 aa)
>NHR-176
MTKKSTIQPCLVCGQSSNSILFGAPSCRACGEFFRRKVISNFKIKNNCLGECSFAKKSMKPCQSCRFQKCLEAGMLEKMV
FSRKAIYSISNFEKSILEELEEAYSKLEHGRNETFNPKSDSNPKFCSHEELNNTCTIDIQIILDNLISYFQAKKPMGKEQ
DDVLKMHFIVPFVLFDTAFRAIGKSSYISPDGTMFGGSYVEKLYQDSSNSKIGVNNGKTSREIMESYWKVSYKILKSEME
LLQLDRSEFLLLSALIYWDFGLENQSDKCCENCNTIREKVLKELVKYERKKSGQNALRIAMIMGLLQAVPKALDVMKTCG
FLSKIYNLRGSGCPLYAISTNSPPQ
Estimated Isoelectric Point:
8.86711883544922
Estimated Molecular Weight:
39.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys35
Gln13
Leu32
Gly19
Met12
Ser37
Tyr12
His3
Glu25
Arg13
Cys16
Phe19
Pro12
Val13
Asn20
Ala15
Ile24
Trp2
Asp12