Sequence:
download
CE35028sequence.fasta
>MED-1 MAYPYPVFNAENVFDNTQQQVGFYDYSTPFNGTYSFTTDYSYYNNYYDYVNTYASYYPTAMDSSSLNISSTTGSPNSSHF TTFTHFSTPSTSPSTSTQSSTTPSNSDNKKSFQCSNCSVTETIRWRNIRSKEGIQCNACFIYQRKYNKTRPVTAVNKYQK RKLKVQETNGVDSF
view sequence (174 aa)
>MED-1
MAYPYPVFNAENVFDNTQQQVGFYDYSTPFNGTYSFTTDYSYYNNYYDYVNTYASYYPTAMDSSSLNISSTTGSPNSSHF
TTFTHFSTPSTSPSTSTQSSTTPSNSDNKKSFQCSNCSVTETIRWRNIRSKEGIQCNACFIYQRKYNKTRPVTAVNKYQK
RKLKVQETNGVDSF
Estimated Isoelectric Point:
8.78636932373047
Estimated Molecular Weight:
19.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr23
Lys9
Gln9
Leu2
Gly5
Met2
Ser26
Tyr17
His2
Glu4
Arg6
Cys4
Phe11
Pro9
Val9
Asn17
Ala6
Ile5
Trp1
Asp7