Sequence:
download
CE34980sequence.fasta
>UNC-2, isoform b MIPIAASEIIPSPIHPRKISINDRLFEIRTPRPGEMIKEAVQMAVWPALPRLAAEEARREQKAESGTFVRKTTLSSNAPV KEKGPSSLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVL KVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKS ILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIG PNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAYFIPLIVLGSFFMLNLVLGVLSGEFAKERERVENR REFLKLRRQQQIERELNGYLEWILTAEEVILKEDRTTEEEKAAIMEARRRAANKKLKQASKQQSTETEEDFEEDEDEMEE EYVDEGGTVEDEFAERKKRGCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEF VFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAEVYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVR SLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPYTHFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIY SGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLANAQELTAAEEADEKANEIEEESEELDEQYQEGDHCTIDMEGKTAGD MCAVARAMDDLDEECEEEESPFGGPKPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEE NPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVL RVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQN DPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPFFRVEVALFYVMFFIVFPFFFVNIF VALIIITFQEQGEAELSEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMK YYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTEFGGHFVSLGFLRLFRAA RLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCAT GEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPHHL DEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNMPVAEDGTVHFTTTLFALIRESLSIKM RPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGLLILENYRARKSGTEVGGQGLFGGGLR SLVAAAKAAESQHSSHTPQPPEETTPIIPQHAQQFSAAPTMSAQGSLQQMQGTSSGGGQRPYSLFNSFVDTIKSGKQDGD VTDVQYQSVDQQHEKMNSTGRRLSDMFSKIRRGTSADHNPHQTEHLLAQDNRSPSSPRYRSMARASPPSPAERYGHPPRY RTESPPSSRSEYQMSIRDPIIRRNRYNTMEHSRSSHDPQYHQDQQQQQQPHHQQHSQHLQHSHHKTYQNHNQYSRSPIYS DDSSVAESYRREREFRRYQDSTPQDVSEDDDPMPTAVRARRLPLISTMPTHYESAYQPSSYNQHLNDSYGLGTGYQRDYH TSHSHSHHPTSQQQQHQPMYSTSPLISPRSSHSYYTPRSSQYYEIPSPSPDIYPSYRGSASPRRYPTSTVVVAPDREGSS ARVIQAQPGSIPLSDSETEDDPRWAIV
view sequence (2027 aa)
>UNC-2, isoform b
MIPIAASEIIPSPIHPRKISINDRLFEIRTPRPGEMIKEAVQMAVWPALPRLAAEEARREQKAESGTFVRKTTLSSNAPV
KEKGPSSLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVL
KVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKS
ILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIG
PNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAYFIPLIVLGSFFMLNLVLGVLSGEFAKERERVENR
REFLKLRRQQQIERELNGYLEWILTAEEVILKEDRTTEEEKAAIMEARRRAANKKLKQASKQQSTETEEDFEEDEDEMEE
EYVDEGGTVEDEFAERKKRGCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEF
VFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAEVYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVR
SLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPYTHFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIY
SGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLANAQELTAAEEADEKANEIEEESEELDEQYQEGDHCTIDMEGKTAGD
MCAVARAMDDLDEECEEEESPFGGPKPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEE
NPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVL
RVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQN
DPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPFFRVEVALFYVMFFIVFPFFFVNIF
VALIIITFQEQGEAELSEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMK
YYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTEFGGHFVSLGFLRLFRAA
RLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCAT
GEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPHHL
DEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNMPVAEDGTVHFTTTLFALIRESLSIKM
RPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGLLILENYRARKSGTEVGGQGLFGGGLR
SLVAAAKAAESQHSSHTPQPPEETTPIIPQHAQQFSAAPTMSAQGSLQQMQGTSSGGGQRPYSLFNSFVDTIKSGKQDGD
VTDVQYQSVDQQHEKMNSTGRRLSDMFSKIRRGTSADHNPHQTEHLLAQDNRSPSSPRYRSMARASPPSPAERYGHPPRY
RTESPPSSRSEYQMSIRDPIIRRNRYNTMEHSRSSHDPQYHQDQQQQQQPHHQQHSQHLQHSHHKTYQNHNQYSRSPIYS
DDSSVAESYRREREFRRYQDSTPQDVSEDDDPMPTAVRARRLPLISTMPTHYESAYQPSSYNQHLNDSYGLGTGYQRDYH
TSHSHSHHPTSQQQQHQPMYSTSPLISPRSSHSYYTPRSSQYYEIPSPSPDIYPSYRGSASPRRYPTSTVVVAPDREGSS
ARVIQAQPGSIPLSDSETEDDPRWAIV
Estimated Isoelectric Point:
6.16393280029297
Estimated Molecular Weight:
231.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr109
Lys77
Gln94
Leu175
Gly113
Met67
Ser151
Tyr81
His48
Glu135
Arg121
Cys35
Phe133
Pro105
Val129
Asn83
Ala129
Ile132
Trp25
Asp85