Sequence:
download
CE34936sequence.fasta
>MYO-3 MSGNPDAFENDPGFPFLGISREARAATAARPFDSKKNCWIPDPEDGFVAAEIQSTTGEQVTVVTVKGNQITVKKDQCQEM NPPKFDKTEDMANLTFLNEASVLGNLKDRYKDLMIYTYSGLFCVVINPYKRLPIYSESVIKHFMGKRRNEMPPHLFAVSD EAYRNMVQDKENQSMLITGESGAGKTENTKKVISYFAIVGATQAASGKEAKDGKKGGTLEEQIVQTNPVLEAFGNAKTVR NNNSSRFGKFIRTHFSGSGKLAGGDIEHYLLEKSRVVRQAPGERCYHIFYQIMSGNDPSLRGKLKLSNDITYYHFCSQAE LTIEGMDDKEEMRLTQEAFDIMGFEDNETMDLYRSTAGIMHMGEMKFKQRPREEQAEPDGEEDALNAAAMLGIQAEEFLK ALTKPRVRVGTEWVNKGQNLEQVNWAVSGLAKAIYARMFKWIITRCNKTLDAKEIERKHFIGVLDIAGFEIFDLNSFEQL WINFVNERLQQFFNHHMFVLEQEEYKREGIAWTFIDFGLDLQACIELIEKPLGIISILDEECIVPKATDMTYAQKLLDQH LGKHPNFQKPKPPKGKQGDAHFAIVHYAGTVRYNATNFLEKNKDPLNDTAVALLKHSTDNSLMLDIWQDYQTQEEAAEAA KAGQTAGGKRGKSSSFATVSMIYRESLNNLMNMLYQTHPHFIRCIIPNEKKASGVIDSALVLNQLTCNGVLEGIRICRKG FPNRMLYPDFKHRYAILAADAAKESDPKKASVGILDKISVDGNLTDEEFKVGETKIFFKAGVLAKLEDLRDEILSRIVTM FQSRIRSYLAKAEVRRRYEQQTGLLVVQRNVRAWCTLRTWEWFKLFGKVKPMLKAGKEQEAMGELAVKIQKLEEAVQRGE IARSQLESQVADLVEEKNALFLSLETEKANLADAEERNEKLNQLKATLESKLSDITGQLEDMQERNEDLARQKKKTDQEL SDTKKHVQDLELSLRKAEQEKQSRDHNIRSLQDEMANQDEAVAKLNKEKKHQEESNRKLNEDLQSEEDKVNHLEKIRNKL EQQMDELEENIDREKRSRGDIEKAKRKVEGDLKVAQENIDEITKQKHDVETTLKRKEEDLHHTNAKLAENNSIIAKLQRL IKELTARNAELEEELEAERNSRQKSDRSRSEAERELEELTERLEQQGGATAAQLEANKKREAEIAKLRREKEEDSLNHET AISSLRKRHGDSVAELTEQLETLQKLKAKSEAEKSKLQRDLEESQHATDSEVRSRQDLEKALKTIEVQYSELQTKADEQS RQLQDFAALKNRLNNENSDLNRSLEEMDNQLNSLHRLKSTLQSQLDETRRNYDEESRERQALAATAKNLEHENTILREHL DEEAESKADLTRQISKLNAEIQQWKARFDSEGLNKLEEIEAAKKALQLKVQELTDTNEGLFAKIASQEKVRFKLMQDLDD AQSDVEKAAAQVAFYEKHRRQFESIIAEWKKKTDDLSSELDAAQRDNRQLSTDLFKAKTANDELAEYLDSTRRENKSLAQ EVKDLTDQLGEGGRSVAELQKIVRKLEVEKEELQKALDEAEAALEAEEAKVLRAQIEVSQIRSEIEKRIQEKEEEFENTR RNHQRALESMQATLEAETKQKEEALRIKKKLESDINDLEIALDHANRAYADAQKTIKKYMETVQELQFQIEEEQRQKDEI REQFLASEKRNAILQSEKDELAQQAEAAERARRNAEAECIELREQNNDLNAHVSALTGQRRKLEGELLAAHAELEEIANE LKNAVEQGQKASADAARLAEELRQEQEHSMHIERIRKGLELQIKEMQIRLDDAENAALKGGKKIIAQLEARIRAIEQELD GEQRRHQDTEKNWRKAERRVKEVEFQVVEEKKNEERLTELVDKLQCKLKIFKRQVEEAEEVAASNLNKYKVLTAQFEQAE ERADIAENALSKMRNKIRASASMAPPDGFPMVPSASSALIRSSSNARFL
view sequence (1969 aa)
>MYO-3
MSGNPDAFENDPGFPFLGISREARAATAARPFDSKKNCWIPDPEDGFVAAEIQSTTGEQVTVVTVKGNQITVKKDQCQEM
NPPKFDKTEDMANLTFLNEASVLGNLKDRYKDLMIYTYSGLFCVVINPYKRLPIYSESVIKHFMGKRRNEMPPHLFAVSD
EAYRNMVQDKENQSMLITGESGAGKTENTKKVISYFAIVGATQAASGKEAKDGKKGGTLEEQIVQTNPVLEAFGNAKTVR
NNNSSRFGKFIRTHFSGSGKLAGGDIEHYLLEKSRVVRQAPGERCYHIFYQIMSGNDPSLRGKLKLSNDITYYHFCSQAE
LTIEGMDDKEEMRLTQEAFDIMGFEDNETMDLYRSTAGIMHMGEMKFKQRPREEQAEPDGEEDALNAAAMLGIQAEEFLK
ALTKPRVRVGTEWVNKGQNLEQVNWAVSGLAKAIYARMFKWIITRCNKTLDAKEIERKHFIGVLDIAGFEIFDLNSFEQL
WINFVNERLQQFFNHHMFVLEQEEYKREGIAWTFIDFGLDLQACIELIEKPLGIISILDEECIVPKATDMTYAQKLLDQH
LGKHPNFQKPKPPKGKQGDAHFAIVHYAGTVRYNATNFLEKNKDPLNDTAVALLKHSTDNSLMLDIWQDYQTQEEAAEAA
KAGQTAGGKRGKSSSFATVSMIYRESLNNLMNMLYQTHPHFIRCIIPNEKKASGVIDSALVLNQLTCNGVLEGIRICRKG
FPNRMLYPDFKHRYAILAADAAKESDPKKASVGILDKISVDGNLTDEEFKVGETKIFFKAGVLAKLEDLRDEILSRIVTM
FQSRIRSYLAKAEVRRRYEQQTGLLVVQRNVRAWCTLRTWEWFKLFGKVKPMLKAGKEQEAMGELAVKIQKLEEAVQRGE
IARSQLESQVADLVEEKNALFLSLETEKANLADAEERNEKLNQLKATLESKLSDITGQLEDMQERNEDLARQKKKTDQEL
SDTKKHVQDLELSLRKAEQEKQSRDHNIRSLQDEMANQDEAVAKLNKEKKHQEESNRKLNEDLQSEEDKVNHLEKIRNKL
EQQMDELEENIDREKRSRGDIEKAKRKVEGDLKVAQENIDEITKQKHDVETTLKRKEEDLHHTNAKLAENNSIIAKLQRL
IKELTARNAELEEELEAERNSRQKSDRSRSEAERELEELTERLEQQGGATAAQLEANKKREAEIAKLRREKEEDSLNHET
AISSLRKRHGDSVAELTEQLETLQKLKAKSEAEKSKLQRDLEESQHATDSEVRSRQDLEKALKTIEVQYSELQTKADEQS
RQLQDFAALKNRLNNENSDLNRSLEEMDNQLNSLHRLKSTLQSQLDETRRNYDEESRERQALAATAKNLEHENTILREHL
DEEAESKADLTRQISKLNAEIQQWKARFDSEGLNKLEEIEAAKKALQLKVQELTDTNEGLFAKIASQEKVRFKLMQDLDD
AQSDVEKAAAQVAFYEKHRRQFESIIAEWKKKTDDLSSELDAAQRDNRQLSTDLFKAKTANDELAEYLDSTRRENKSLAQ
EVKDLTDQLGEGGRSVAELQKIVRKLEVEKEELQKALDEAEAALEAEEAKVLRAQIEVSQIRSEIEKRIQEKEEEFENTR
RNHQRALESMQATLEAETKQKEEALRIKKKLESDINDLEIALDHANRAYADAQKTIKKYMETVQELQFQIEEEQRQKDEI
REQFLASEKRNAILQSEKDELAQQAEAAERARRNAEAECIELREQNNDLNAHVSALTGQRRKLEGELLAAHAELEEIANE
LKNAVEQGQKASADAARLAEELRQEQEHSMHIERIRKGLELQIKEMQIRLDDAENAALKGGKKIIAQLEARIRAIEQELD
GEQRRHQDTEKNWRKAERRVKEVEFQVVEEKKNEERLTELVDKLQCKLKIFKRQVEEAEEVAASNLNKYKVLTAQFEQAE
ERADIAENALSKMRNKIRASASMAPPDGFPMVPSASSALIRSSSNARFL
Estimated Isoelectric Point:
5.51013946533203
Estimated Molecular Weight:
225.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr83
Lys179
Gln127
Leu192
Gly80
Met40
Ser106
Tyr32
His39
Glu252
Arg131
Cys14
Phe61
Pro35
Val80
Asn101
Ala192
Ile101
Trp13
Asp111