Sequence:
download
CE34783sequence.fasta
>ELO-3 MAKYDYNPKYGLENYSIFLPFETSFDAFRSTTWMQNHWYQSITASVVYVAVIFTGKKIMEKYKPFQLDTPLFVWNSFLAI FSILGFLRMTPEFVWSWSAEGNSFKYSICHSSYAQGVTGFWTEQFAMSKLFELIDTIFIVLRKRPLIFLHWYHHVTVMIY TWHAYKDHTASGRWFIWMNYGVHALMYSYYALRSLKFRLPKQMAMVVTTLQLAQMVMGVIIGVTVYRIKSSGEYCQQTWD NLGLCFGVYFTYFLLFANFFYHAYVKKNNRYTEVKKDKKEKEEPVDFEILEPKEDINANIAEPSITTRSAAARRKVQKAD
view sequence (320 aa)
>ELO-3
MAKYDYNPKYGLENYSIFLPFETSFDAFRSTTWMQNHWYQSITASVVYVAVIFTGKKIMEKYKPFQLDTPLFVWNSFLAI
FSILGFLRMTPEFVWSWSAEGNSFKYSICHSSYAQGVTGFWTEQFAMSKLFELIDTIFIVLRKRPLIFLHWYHHVTVMIY
TWHAYKDHTASGRWFIWMNYGVHALMYSYYALRSLKFRLPKQMAMVVTTLQLAQMVMGVIIGVTVYRIKSSGEYCQQTWD
NLGLCFGVYFTYFLLFANFFYHAYVKKNNRYTEVKKDKKEKEEPVDFEILEPKEDINANIAEPSITTRSAAARRKVQKAD
Estimated Isoelectric Point:
9.19011688232422
Estimated Molecular Weight:
37.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr21
Lys23
Gln11
Leu23
Gly13
Met12
Ser21
Tyr23
His9
Glu16
Arg12
Cys3
Phe26
Pro10
Val22
Asn12
Ala22
Ile20
Trp11
Asp10