Sequence:
download
CE34766sequence.fasta
>C49H3.4 MAEDFDIEKFLKTVAEKNPELIEGVEGNSEDFKTDEFEKNLVDLHPELAEEICDFDERTVREEKEKTISKKQQARDRQIR LEAMMTDGRSVIEKKGITFHDKMITIEGPMSMIANAVINQKRIEVRVRSAIRIDRIFEGIPTTFDEHFNLMMKDVTETVL HGRKAQKEFTNRKEMQLLLPEFLRWKEGGNWPMKVGTNRLIEHRFQRACFIKGDSVVLVRMLP
view sequence (223 aa)
>C49H3.4
MAEDFDIEKFLKTVAEKNPELIEGVEGNSEDFKTDEFEKNLVDLHPELAEEICDFDERTVREEKEKTISKKQQARDRQIR
LEAMMTDGRSVIEKKGITFHDKMITIEGPMSMIANAVINQKRIEVRVRSAIRIDRIFEGIPTTFDEHFNLMMKDVTETVL
HGRKAQKEFTNRKEMQLLLPEFLRWKEGGNWPMKVGTNRLIEHRFQRACFIKGDSVVLVRMLP
Estimated Isoelectric Point:
5.86688995361328
Estimated Molecular Weight:
26.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr13
Lys20
Gln7
Leu15
Gly11
Met11
Ser6
His5
Glu28
Arg18
Cys2
Phe13
Pro7
Val14
Asn9
Ala10
Ile18
Trp2
Asp14