Sequence:
download
CE34623sequence.fasta
>UNC-13, isoform b MNPVPSLAVPMSPGPYLNSDPPSPVSPNPQIKRSIYRIKESYEDRNGGRERIYTTNLVSVYLEKMKPPDELEEGSSGSMR ETQNEIKNGTQLHNAESNIFFPQDSVPKSISYNAGNLKNTSITTSKTSSAITNHSSLPPQPPSKPASRDSDPMKQLLTFS KSFKKVRRVRSAMPRRRKRKRVKIKKSRSCPILWKTEKTPHPMKSKSMTCIRIPKKTVIAPLRKEIKIVRMKPPAARCES DSKAHKKKNLLDVYKDMGKSTVLDGNGSSAANAFYKSIDAAPNMNVARTKTSIPLVSELVLKTMATKRAQAGLANAARTT FSDTELKTHVYKKTLQALIYPISATTPHNFATTTFQTPTFCYECEGLLWGLARQGLRCTQCQVKVHDKCRELLSADCLQR AAEKSTKHGEADRTQSLVNVIRDRMKIQEQNKPEVFQMIRTVFDVDENIQKETLKTVKASILEGSSKWSAKITLTVLCAQ GLIAKDKTGKSDPYVTAQVGKTKRRTRTIHQELNPVWNEKFHFECHNSTDRIKVRVWDEDNDLKSKLRQKLTRESDDFLG QTVIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHINVEIKGEEKLAPYHVQYTCLHEHLFAAHCVDEEVKLPKVRGEDS WKVCFQETGQEIAEEFAMRYGIESIYQAMTHFACLCTRYMCAGVPAVLSTLLANINAYYAHTTATSAVSAPDRFAASNFG KERFVKLLDQLHNSLRIDLSAYRNHFPSSSPAKLQDLKSTVDLLTSITFFRMKVLELASPPRASTVVRECAKACMQQTYQ LMFESCAEQFPILDTSVQFWYEFIDYIMRVIEEDQKNYTPALNQFPQELNVGNLSAETLWSMYKNDLKMALEEHAQKKRC KTPEYMNLYFKVKGFYFKYVADLSTYKSSIPEFPAWFIPFVMDWLNENDEHSMDILRNAYNVDKADNFPQTSEHTKFSNS VVDVFTQLNAALKLLKQMDCPNPEVAADMMKRFSKTLNKVLLAYADMVQKDFPKFAHDEKLACILMNNVQQLRVQLEKIY ETMGGAELDEHIGQVLTVLQKKLNSVLDRLSAEFVTTLEPHIHEQTIKLGMLLVKIKGPQLQKTQVQPEADAVLEPLMDL LEGSLRRYADQCEKTVLKYILKELWKITIVNMEKRVVLPPLSDKALLKQLPNAKIGDVTKLMSTNIQSIKGMNSVKDMMD MARESEKSLTPRQCTVLDCALDAIKDSFHASGKGLKKSFFEKSPELQSLKYALSLYTQTTEQLIKTFITSQRQQDLPSQE QPVGEVSVQVDLFSHPGTGEQKVTVKILAANDLRWQTSSAFKPFVEVHLVGPHLSDKKRKWSTKTKAGNWAPKFNETFHF FLGNEGEPEHYELMFQVKDYCFARDDRVVGVGVLQLSSVVDQAGSCAMWVQLGTRLHIDETGLILLRILSQRQTDEVAKD FVRLKTECRYETETVMAASASSQNINRT
view sequence (1468 aa)
>UNC-13, isoform b
MNPVPSLAVPMSPGPYLNSDPPSPVSPNPQIKRSIYRIKESYEDRNGGRERIYTTNLVSVYLEKMKPPDELEEGSSGSMR
ETQNEIKNGTQLHNAESNIFFPQDSVPKSISYNAGNLKNTSITTSKTSSAITNHSSLPPQPPSKPASRDSDPMKQLLTFS
KSFKKVRRVRSAMPRRRKRKRVKIKKSRSCPILWKTEKTPHPMKSKSMTCIRIPKKTVIAPLRKEIKIVRMKPPAARCES
DSKAHKKKNLLDVYKDMGKSTVLDGNGSSAANAFYKSIDAAPNMNVARTKTSIPLVSELVLKTMATKRAQAGLANAARTT
FSDTELKTHVYKKTLQALIYPISATTPHNFATTTFQTPTFCYECEGLLWGLARQGLRCTQCQVKVHDKCRELLSADCLQR
AAEKSTKHGEADRTQSLVNVIRDRMKIQEQNKPEVFQMIRTVFDVDENIQKETLKTVKASILEGSSKWSAKITLTVLCAQ
GLIAKDKTGKSDPYVTAQVGKTKRRTRTIHQELNPVWNEKFHFECHNSTDRIKVRVWDEDNDLKSKLRQKLTRESDDFLG
QTVIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHINVEIKGEEKLAPYHVQYTCLHEHLFAAHCVDEEVKLPKVRGEDS
WKVCFQETGQEIAEEFAMRYGIESIYQAMTHFACLCTRYMCAGVPAVLSTLLANINAYYAHTTATSAVSAPDRFAASNFG
KERFVKLLDQLHNSLRIDLSAYRNHFPSSSPAKLQDLKSTVDLLTSITFFRMKVLELASPPRASTVVRECAKACMQQTYQ
LMFESCAEQFPILDTSVQFWYEFIDYIMRVIEEDQKNYTPALNQFPQELNVGNLSAETLWSMYKNDLKMALEEHAQKKRC
KTPEYMNLYFKVKGFYFKYVADLSTYKSSIPEFPAWFIPFVMDWLNENDEHSMDILRNAYNVDKADNFPQTSEHTKFSNS
VVDVFTQLNAALKLLKQMDCPNPEVAADMMKRFSKTLNKVLLAYADMVQKDFPKFAHDEKLACILMNNVQQLRVQLEKIY
ETMGGAELDEHIGQVLTVLQKKLNSVLDRLSAEFVTTLEPHIHEQTIKLGMLLVKIKGPQLQKTQVQPEADAVLEPLMDL
LEGSLRRYADQCEKTVLKYILKELWKITIVNMEKRVVLPPLSDKALLKQLPNAKIGDVTKLMSTNIQSIKGMNSVKDMMD
MARESEKSLTPRQCTVLDCALDAIKDSFHASGKGLKKSFFEKSPELQSLKYALSLYTQTTEQLIKTFITSQRQQDLPSQE
QPVGEVSVQVDLFSHPGTGEQKVTVKILAANDLRWQTSSAFKPFVEVHLVGPHLSDKKRKWSTKTKAGNWAPKFNETFHF
FLGNEGEPEHYELMFQVKDYCFARDDRVVGVGVLQLSSVVDQAGSCAMWVQLGTRLHIDETGLILLRILSQRQTDEVAKD
FVRLKTECRYETETVMAASASSQNINRT
Estimated Isoelectric Point:
9.07176971435547
Estimated Molecular Weight:
166.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr101
Lys132
Gln74
Leu136
Gly52
Met44
Ser112
Tyr41
His34
Glu96
Arg73
Cys29
Phe56
Pro71
Val98
Asn62
Ala101
Ile66
Trp16
Asp74