Sequence:
download
CE34599sequence.fasta
>SET-1, isoform b MEYSEAKVIEEQYSNDEEIGSYMYFFEHNNKKWCIDATKESPWKGRLINHSVLRPNLKTKVVEIDGSHHLILVARRQIAQ GEELLYDYGDRSAETIAKNPWLVNT
view sequence (105 aa)
>SET-1, isoform b
MEYSEAKVIEEQYSNDEEIGSYMYFFEHNNKKWCIDATKESPWKGRLINHSVLRPNLKTKVVEIDGSHHLILVARRQIAQ
GEELLYDYGDRSAETIAKNPWLVNT
Estimated Isoelectric Point:
5.53256988525391
Estimated Molecular Weight:
12.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr4
Lys8
Gln3
Leu8
Gly5
Met2
Ser7
Tyr6
His4
Glu12
Arg5
Cys1
Phe2
Pro3
Val6
Asn7
Ala6
Ile8
Trp3
Asp5