Sequence:
download
CE34547sequence.fasta
>AAT-8 MPKKEDNKIGLIGATSYIVGSIIGSGIFIAPKGIVEHAGSVGLSLIIWVFCALLNMITAINYIELGTSIPESGADLAYID YMGWTPIAFSLLWLSLLIQSSSSAAVLYLTFGKYLVQALEPIVCFTSSGADNCAKLFGFGLLLFLTLTNMFSLNKFAARV QIISMCSKIFATLIIIGIGFFFIIFRGATSHYRSSEIMKGSDWNAGAIALAIYQGNWAFGGFTTLNYGTEEIQIENFRKT LPRACLGGLLISAVIYVLVNVSYFAILTPQEIIDSSAVATTFIQRTVGNGPAFAVPAVVGFLLVGTLNGDVFGWSRYMVA GSRRKMMPTCFSLIHVDNDSPRVSVFFHTLTSIIFAFMGDTDQLVDYLTVTGMLTTIFALLVLVIIKWKKMPIASDPVKY SIFWPILNLVIMIALLVIPIQQDPLSSIIGFSMFLGGVVVYFIIKFVVSHTEFLGVIDEKLTHLCQILTWTIVDSGPEEK TRL
view sequence (483 aa)
>AAT-8
MPKKEDNKIGLIGATSYIVGSIIGSGIFIAPKGIVEHAGSVGLSLIIWVFCALLNMITAINYIELGTSIPESGADLAYID
YMGWTPIAFSLLWLSLLIQSSSSAAVLYLTFGKYLVQALEPIVCFTSSGADNCAKLFGFGLLLFLTLTNMFSLNKFAARV
QIISMCSKIFATLIIIGIGFFFIIFRGATSHYRSSEIMKGSDWNAGAIALAIYQGNWAFGGFTTLNYGTEEIQIENFRKT
LPRACLGGLLISAVIYVLVNVSYFAILTPQEIIDSSAVATTFIQRTVGNGPAFAVPAVVGFLLVGTLNGDVFGWSRYMVA
GSRRKMMPTCFSLIHVDNDSPRVSVFFHTLTSIIFAFMGDTDQLVDYLTVTGMLTTIFALLVLVIIKWKKMPIASDPVKY
SIFWPILNLVIMIALLVIPIQQDPLSSIIGFSMFLGGVVVYFIIKFVVSHTEFLGVIDEKLTHLCQILTWTIVDSGPEEK
TRL
Estimated Isoelectric Point:
6.59331512451172
Estimated Molecular Weight:
52.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr32
Lys18
Gln11
Leu54
Gly40
Met14
Ser39
Tyr15
His6
Glu14
Arg11
Cys7
Phe35
Pro17
Val37
Asn15
Ala35
Ile58
Trp9
Asp16