Sequence:
download
CE34521sequence.fasta
>SRW-140 MAQQDMSFCSQIEVFYPNIQTSTALFLCRIADGLGAYYNTVFENESRVAAVSFSINLFHFIILTRKPMINSSVNIIMAAI AFFDICTLLYEMQLIVQSIIFLYTHCFQSGSYAWVLFNLVLEALRDYSRRCSTWLCLSIALLRILVMKNPLNQKYMRLVN PIGAFYAISIMVLVNVPITVFNLMKYTIKGIIRKSLCFPNGRVTYYMDFVEAFTNNDGALLKVATTSNAIMTNIIPCFVY PIFTLFLVSELKKVNKNRQSLSSTKNSTESQKTTRLVLLLTAMFFIAEFPLGVSTFLTYLFYDIQGIFVIIRFCEFLFSV ILYANFSSHFIICLLMSSQYRECAMKFIFCGFSPKKALTRLTTTQNNSRRWATATTKLS
view sequence (379 aa)
>SRW-140
MAQQDMSFCSQIEVFYPNIQTSTALFLCRIADGLGAYYNTVFENESRVAAVSFSINLFHFIILTRKPMINSSVNIIMAAI
AFFDICTLLYEMQLIVQSIIFLYTHCFQSGSYAWVLFNLVLEALRDYSRRCSTWLCLSIALLRILVMKNPLNQKYMRLVN
PIGAFYAISIMVLVNVPITVFNLMKYTIKGIIRKSLCFPNGRVTYYMDFVEAFTNNDGALLKVATTSNAIMTNIIPCFVY
PIFTLFLVSELKKVNKNRQSLSSTKNSTESQKTTRLVLLLTAMFFIAEFPLGVSTFLTYLFYDIQGIFVIIRFCEFLFSV
ILYANFSSHFIICLLMSSQYRECAMKFIFCGFSPKKALTRLTTTQNNSRRWATATTKLS
Estimated Isoelectric Point:
9.32886505126953
Estimated Molecular Weight:
43.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr29
Lys16
Gln13
Leu43
Gly10
Met14
Ser32
Tyr17
His3
Glu11
Arg17
Cys12
Phe34
Pro10
Val24
Asn23
Ala25
Ile36
Trp3
Asp7