Sequence:
download
CE34375sequence.fasta
>VAB-19 MRDIGGSMSSASTSATIVKRSPPNDTSTSSGVSCDVSPNSMTSPSSGSDQNQNNNSLNKCKCCPYGYHIDLGFVSYAQNV SNGFVSRQGTPTNMTLRGNGADRHLMSPLLDNSIFSDSLDNLMSDFDDVLAPHKEVEKKKTVQDIRSRMQGGYNSDYTTY RRGPPEIPRRAHFEQAKPPPLSRPINLGFSGSRSNTPTQRFNAPNGTGNGYSTALAKTISEIRARNAESPFPDSRVGTPI DLGLHQQNNGHVTPSRFANNRYDDLPPTPTPTFRRAPSQGDLPRGFSTAPSTGPGDFASLRRGREFALPPEQEHHSRRFF SASPKLPRRGLQAGPSIDVESHFTYAQTQNGQKVLARTQSTSTSPPPQAPASAFEPVKPLSNGSPSPTHQVQKPIVTRSI AVSTGPLPAPKPCGECAGLRKELFLAVEKIPPPPPESCHVSTSTVLLEFADQSVGSEPIKHCHVALGTEPTSTREVGTVP VTVRSLHIDTQTDPAASTVDAACSPVLFETQEEAVKVTVAASSSAAAADCEECLKRQDVFTRNVGVGACSISDKICVSCD NQVVEADENEAPGFKTDTKDDQKQRDFEIAKANAVKKLLTNEQKSNFQRGTAVSKSARYDRKRSVDDLDYIVDKKNATSP ATSSQEAPPTVPDASESPLTTKVVLKKEVFIEPPKQMLPDPIPARIPRPKISKWAVTSEEEAAETPDEQEEAQDRLTPLR SDMRQLGNRWNRNQVTTASNTTPHLPYSGATSQEDVSDSDAESDCSAHSDATFEVNDDVFDAAPFEVSDRLREALENFNS SILEPGSVAEETVEWSAKLVRHVWMTTAGNSSSRYENVDRFVAELGNLGPQILHMVVNFCDQNGNTALHYAVSHANFAVV SSILDSGECDLDAPNRAGYTAVMLAALSQLDDDMEKAVVHRLFQMGNVNAKASQHGQTALMLAVSHGKKTTTELLLACGA NVNEQDQDGSTALMCAAEHGHKELVKMLLAENLVNASLTDVDNSTALSIALENDHREIGVMIYAYLNYGRLDISGPTSTI
view sequence (1040 aa)
>VAB-19
MRDIGGSMSSASTSATIVKRSPPNDTSTSSGVSCDVSPNSMTSPSSGSDQNQNNNSLNKCKCCPYGYHIDLGFVSYAQNV
SNGFVSRQGTPTNMTLRGNGADRHLMSPLLDNSIFSDSLDNLMSDFDDVLAPHKEVEKKKTVQDIRSRMQGGYNSDYTTY
RRGPPEIPRRAHFEQAKPPPLSRPINLGFSGSRSNTPTQRFNAPNGTGNGYSTALAKTISEIRARNAESPFPDSRVGTPI
DLGLHQQNNGHVTPSRFANNRYDDLPPTPTPTFRRAPSQGDLPRGFSTAPSTGPGDFASLRRGREFALPPEQEHHSRRFF
SASPKLPRRGLQAGPSIDVESHFTYAQTQNGQKVLARTQSTSTSPPPQAPASAFEPVKPLSNGSPSPTHQVQKPIVTRSI
AVSTGPLPAPKPCGECAGLRKELFLAVEKIPPPPPESCHVSTSTVLLEFADQSVGSEPIKHCHVALGTEPTSTREVGTVP
VTVRSLHIDTQTDPAASTVDAACSPVLFETQEEAVKVTVAASSSAAAADCEECLKRQDVFTRNVGVGACSISDKICVSCD
NQVVEADENEAPGFKTDTKDDQKQRDFEIAKANAVKKLLTNEQKSNFQRGTAVSKSARYDRKRSVDDLDYIVDKKNATSP
ATSSQEAPPTVPDASESPLTTKVVLKKEVFIEPPKQMLPDPIPARIPRPKISKWAVTSEEEAAETPDEQEEAQDRLTPLR
SDMRQLGNRWNRNQVTTASNTTPHLPYSGATSQEDVSDSDAESDCSAHSDATFEVNDDVFDAAPFEVSDRLREALENFNS
SILEPGSVAEETVEWSAKLVRHVWMTTAGNSSSRYENVDRFVAELGNLGPQILHMVVNFCDQNGNTALHYAVSHANFAVV
SSILDSGECDLDAPNRAGYTAVMLAALSQLDDDMEKAVVHRLFQMGNVNAKASQHGQTALMLAVSHGKKTTTELLLACGA
NVNEQDQDGSTALMCAAEHGHKELVKMLLAENLVNASLTDVDNSTALSIALENDHREIGVMIYAYLNYGRLDISGPTSTI
Estimated Isoelectric Point:
5.49230194091797
Estimated Molecular Weight:
112.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr76
Lys44
Gln44
Leu71
Gly58
Met18
Ser110
Tyr18
His26
Glu61
Arg57
Cys19
Phe33
Pro79
Val72
Asn57
Ala94
Ile32
Trp4
Asp67