Sequence:
download
CE34229sequence.fasta
>CEH-91 MENWYPCIICGIARYGHDVIATPRLTSDARVNQWLNLIGKPALNRILATNKNPTLNTFICIEHFEPEELIEPKKRRMKPI KTTRREMAIYENYFRDHGYFETQKSDVNRKKSMKLTSISCSQCSESVERDGKFAKIDMVDHAKLHMELGDCRCEKHKKIE RIDRIDGENSDFQCSECAFILNAELEAVKEKAEFCFPMFQFEKSKFSNSTLEPRMKPEYIESRPFWNSEEYDPVFLDSDV KFDLIEDFEPPEPEPEPEQVDTELVKLEPIDGDYEHMEGCFSGFEQEESEQPSTSSAPRKLVQQRDRLLENLYQSNRHPS MEDINSLLDFSGDQRSIEAIFGFFERRRNDDNEMCTGDDACSSLRRYLEMELHPHGPLLEPPEIRCRMIKMFEKHWAKYR YVFRDLHSYMFSDALGLPPKYIRQRFEHFKERKNQQQKKQQEEADRAFRERHKPPKPHKPKPKSQYSKFEDETMEKAYMR TVKMNPSSYESRDLLESISISLRMSLIKVHEWFNNRKFVDSIIDQTWRTFSVNDEKRLHSTFLQNPQPTDEQYCYLAKEL RAPVKEVMNWFKLKQMNEEREEEALKFEYKLDALTQESIDLFTTIVDGTTVVSVAKRRLLALELDVPYETLGRWIFYYRN REEKSRKSPKLEDDDDPPPRLAKMPRLEMNEPDNEEDIKLEPLDS
view sequence (685 aa)
>CEH-91
MENWYPCIICGIARYGHDVIATPRLTSDARVNQWLNLIGKPALNRILATNKNPTLNTFICIEHFEPEELIEPKKRRMKPI
KTTRREMAIYENYFRDHGYFETQKSDVNRKKSMKLTSISCSQCSESVERDGKFAKIDMVDHAKLHMELGDCRCEKHKKIE
RIDRIDGENSDFQCSECAFILNAELEAVKEKAEFCFPMFQFEKSKFSNSTLEPRMKPEYIESRPFWNSEEYDPVFLDSDV
KFDLIEDFEPPEPEPEPEQVDTELVKLEPIDGDYEHMEGCFSGFEQEESEQPSTSSAPRKLVQQRDRLLENLYQSNRHPS
MEDINSLLDFSGDQRSIEAIFGFFERRRNDDNEMCTGDDACSSLRRYLEMELHPHGPLLEPPEIRCRMIKMFEKHWAKYR
YVFRDLHSYMFSDALGLPPKYIRQRFEHFKERKNQQQKKQQEEADRAFRERHKPPKPHKPKPKSQYSKFEDETMEKAYMR
TVKMNPSSYESRDLLESISISLRMSLIKVHEWFNNRKFVDSIIDQTWRTFSVNDEKRLHSTFLQNPQPTDEQYCYLAKEL
RAPVKEVMNWFKLKQMNEEREEEALKFEYKLDALTQESIDLFTTIVDGTTVVSVAKRRLLALELDVPYETLGRWIFYYRN
REEKSRKSPKLEDDDDPPPRLAKMPRLEMNEPDNEEDIKLEPLDS
Estimated Isoelectric Point:
5.46356964111328
Estimated Molecular Weight:
81.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr25
Lys55
Gln25
Leu54
Gly17
Met23
Ser47
Tyr23
His17
Glu82
Arg52
Cys15
Phe37
Pro44
Val23
Asn29
Ala27
Ile35
Trp8
Asp47