Sequence:
download
CE34007sequence.fasta
>NAC-1 MARKRGISSLLLIYKQSFVIWGALLIFSPLLMFVGDSHGLQAKCLYCVAVMGSYWVFEALPLAITAFIPMILFPLFGIMR SEEVARAYLPDTCFLFMGGLMVALAVEKCELHARVALFVLKTVGSEPARVMAGFMGVTGFLSMWISNTATTALMVPILQS VITELVSNHRMEDLVALCEAHHNSSRKHSVGMRRLSLPNENNEIKREEMDTAMSPREQKMAKGLMLSVCFSANIGGAATI TGTASNLVLVGQLNELFPGADTGVNFLSWLIFAFPMVFCCLIYCWCVLYLLYLRDAPKGSIIVTRKLQQKYNELHAFSFA EMAVIFCFALLLVLWILREPQVVPGWGEMFKDEFVSDATSAMFIVILLFTLPEKLPSSRGSSEQRKASSGLLDWATVQDR FPWSVLFLLGGGFALAAGVKESGLSHDIGAIMRYLDVFNHNIIMLICIIISVTLTNVCSNTVIASIFIPIVAELARSLEI DPLNFMLPVTISASFAFLLPVATPPNAIVFSSGYLKVFDMFVSGLCVTLGCVVLSMLNMLLWAGFVFNLHLFPQWAANPS PPLDVQDWAVENNITFVGTSKL
view sequence (582 aa)
>NAC-1
MARKRGISSLLLIYKQSFVIWGALLIFSPLLMFVGDSHGLQAKCLYCVAVMGSYWVFEALPLAITAFIPMILFPLFGIMR
SEEVARAYLPDTCFLFMGGLMVALAVEKCELHARVALFVLKTVGSEPARVMAGFMGVTGFLSMWISNTATTALMVPILQS
VITELVSNHRMEDLVALCEAHHNSSRKHSVGMRRLSLPNENNEIKREEMDTAMSPREQKMAKGLMLSVCFSANIGGAATI
TGTASNLVLVGQLNELFPGADTGVNFLSWLIFAFPMVFCCLIYCWCVLYLLYLRDAPKGSIIVTRKLQQKYNELHAFSFA
EMAVIFCFALLLVLWILREPQVVPGWGEMFKDEFVSDATSAMFIVILLFTLPEKLPSSRGSSEQRKASSGLLDWATVQDR
FPWSVLFLLGGGFALAAGVKESGLSHDIGAIMRYLDVFNHNIIMLICIIISVTLTNVCSNTVIASIFIPIVAELARSLEI
DPLNFMLPVTISASFAFLLPVATPPNAIVFSSGYLKVFDMFVSGLCVTLGCVVLSMLNMLLWAGFVFNLHLFPQWAANPS
PPLDVQDWAVENNITFVGTSKL
Estimated Isoelectric Point:
6.22353363037109
Estimated Molecular Weight:
64.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr25
Lys18
Gln12
Leu79
Gly36
Met27
Ser46
Tyr10
His10
Glu26
Arg20
Cys15
Phe41
Pro27
Val51
Asn22
Ala51
Ile38
Trp12
Asp16