Sequence:
download
CE33810sequence.fasta
>R09F10.3 MSGAGHSLNSDPVTTIATSSSEPVTSPSSASHVPVQTAPASHGAPSSVASQPPASVDGKAGAPDEARTASSASNPQGSEH PGSVDPAATTTAATTSASTTSITSTAATTTTTTTTGTTATGRVSPTIPPETLFHDAIKRCNNCLFLIRKLRNKQDHIARL FLDTSGNDQAEFNSAFQNYKDFGLMVHEVMMFYDKLDHIARHLPKALPPIDNINLMRTLYTQEHTMCHININNLLEKMID CGNWNEGNFQTFFYLSELLRCGSTRKYSNLPEQRLVPPAMFHSQATNSHAAFEHAFNGLRKEIANKSLGIYPKVLQRTTC SLIIEFLFGCGGAKPGEKNTDKEIVYTIKFLIIERNGSIEYINIMAPTEDWHMVNDYAIPTINPFAPSRYEVYRRLTKQA NIHLFNCFAQNRWTAGTLFHFISLYGKFRELFTTKCRSCKQVLSRKNFLPPLIFDIRNPNNAAHEVCR
view sequence (468 aa)
>R09F10.3
MSGAGHSLNSDPVTTIATSSSEPVTSPSSASHVPVQTAPASHGAPSSVASQPPASVDGKAGAPDEARTASSASNPQGSEH
PGSVDPAATTTAATTSASTTSITSTAATTTTTTTTGTTATGRVSPTIPPETLFHDAIKRCNNCLFLIRKLRNKQDHIARL
FLDTSGNDQAEFNSAFQNYKDFGLMVHEVMMFYDKLDHIARHLPKALPPIDNINLMRTLYTQEHTMCHININNLLEKMID
CGNWNEGNFQTFFYLSELLRCGSTRKYSNLPEQRLVPPAMFHSQATNSHAAFEHAFNGLRKEIANKSLGIYPKVLQRTTC
SLIIEFLFGCGGAKPGEKNTDKEIVYTIKFLIIERNGSIEYINIMAPTEDWHMVNDYAIPTINPFAPSRYEVYRRLTKQA
NIHLFNCFAQNRWTAGTLFHFISLYGKFRELFTTKCRSCKQVLSRKNFLPPLIFDIRNPNNAAHEVCR
Estimated Isoelectric Point:
8.55757904052734
Estimated Molecular Weight:
51.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr46
Lys21
Gln14
Leu34
Gly23
Met10
Ser39
Tyr12
His18
Glu22
Arg23
Cys11
Phe25
Pro30
Val17
Asn32
Ala42
Ile29
Trp3
Asp17