Sequence:
download
CE33754sequence.fasta
>GTL-1 MDRKRGSIVPAIHKAVAESLRANSVTVEENESERETETQTKRRRKKQRSTSSDKAPLNSAPRHVQKFDWKDMLHLADISG RKRGNSTTSHSGHATRAGSLKGKNWIECRLKMRQCSYFVPSQRFSERCGCGKERSKHTEEVLERSQNKNHPLNHLTLPGI HEVDTTDADADDNEVNLTPGRWSIQSHTEIVPTDAYGNIVFEGTAHHAQYARISFDSDPRDIVHLMMKVWKLKPPKLIIT INGGLTKFDLQPKLARTFRKGIMKIAKSTDAWIITSGLDEGVVKHLDSALHDHGNHTSKNHVVAIGIASWGMLKQRSRFV GKDSTVTYATNVFNNTRLKELNDNHSYFLFSDNGTVNRYGAEIIMRKRLEAYLAQGDKKRSAIPLVCVVLEGGAFTIKMV HDYVTTIPRIPVIVCDGSGRAADILAFAHQAVSQNGFLSDNIRNQLVNIVRRIFGYDPKTAQKLIKQIVECSTNKSLMTI FRLGESSREDLDHVIMSCLLKGQNLSPPEQLQLALAWNRADIARTEIFANGTEWTTQDLHNAMIEALSNDRIDFVHLLLE NGVSMQKFLTYGRLEHLYNTDKGPQNTLRTNLLVDSKHHIKLVEVGRLVENLMGNLYKSNYTKEEFKNQYFLFNNRKQFG KRVHSNSNGGRNDVIGPSGDAGRERMSSMQISLINNARNSIISLFNGGGRKRESDDEDDFSNLEEEANMDFTFRYPYSDL MIWAVLTKRQKMAKLMWTHGEEGMAKALVASRLYVSLAKTASLATGEIGMSQDFTEFSDEFSELAVEVLEYCTKHGRDQT LRLLTCELANWGDETCLSLAANNGHRKFLAHPCCQMLLSDLWQGGLLMKNNQNSKVLTCLAAPPLIFLLGFKTKEQLMLQ PKTAAEHDEEMSDSEMNSAEDTDTSSDSSSDSDDSDEEDAKLRAQSLSADQPLSIHRLVRDKLNFSEKKKPDMGISRIVV APPIVTGRNRARTMSIKKSKKNVIKPPACLKIETSDDDEQEQKKATEMYINRTGKRGSVAVAMNHDDMYIDPSEELDTQT RQKSSREFSSSRNVTVQVYTQRPLSWKKKIMEFYKAPITTYWLWFFAFIWFLILLTYNLLVKTQRIASWSEWYVFAYIFV WTLEIGRKVVSTIMMDTSKPVLKQLRVFFFQYRNGLLAFGLLTYLIAYFIRLSPTTKTLGRILIICNSVIWSLKLVDYLS VQQGLGPYINIVAEMIPTMIPLCVLVFITLYAFGLLRQSITYPYEDWHWILVRNIFLQPYFMLYGEVYAAEIDTCGDEIW QTHEDENIPISMLNVTHETCVPGYWIAPVGLTVFMLATNVLLMNVMVAGCTYIFEKHIQSTREIFLFERYGQVMEYESTP WLPPPFTIIYHVIWLFKLIKSSSRMFERKNLFDQSLKLFLSPDEMEKVHTFEEESVEDMKRETEKKNLSSNDERIHRTAE RTDAILNRVSHLTQLEFTLKEEIRELEHKMKNMDSRHKEQMNLMLDMNKKLGKFISGKYKRGSFGGSGSDGGGGSSDNSK LEPNNSVPMITVDGPSPIGSRRTSGQYLKRDSLQAKKKITENRRSSLEQPKIPSIQFNLMEDQDESAAESATEEVSISIP VPQMRVRQVTESDKSDLSEDDLITREDAPPTSINLPRGPRRHALYSTIADAIETEDDFYADSPVPMPMTPVQPADGSFFG ENDSRYQRDDSDYE
view sequence (1694 aa)
>GTL-1
MDRKRGSIVPAIHKAVAESLRANSVTVEENESERETETQTKRRRKKQRSTSSDKAPLNSAPRHVQKFDWKDMLHLADISG
RKRGNSTTSHSGHATRAGSLKGKNWIECRLKMRQCSYFVPSQRFSERCGCGKERSKHTEEVLERSQNKNHPLNHLTLPGI
HEVDTTDADADDNEVNLTPGRWSIQSHTEIVPTDAYGNIVFEGTAHHAQYARISFDSDPRDIVHLMMKVWKLKPPKLIIT
INGGLTKFDLQPKLARTFRKGIMKIAKSTDAWIITSGLDEGVVKHLDSALHDHGNHTSKNHVVAIGIASWGMLKQRSRFV
GKDSTVTYATNVFNNTRLKELNDNHSYFLFSDNGTVNRYGAEIIMRKRLEAYLAQGDKKRSAIPLVCVVLEGGAFTIKMV
HDYVTTIPRIPVIVCDGSGRAADILAFAHQAVSQNGFLSDNIRNQLVNIVRRIFGYDPKTAQKLIKQIVECSTNKSLMTI
FRLGESSREDLDHVIMSCLLKGQNLSPPEQLQLALAWNRADIARTEIFANGTEWTTQDLHNAMIEALSNDRIDFVHLLLE
NGVSMQKFLTYGRLEHLYNTDKGPQNTLRTNLLVDSKHHIKLVEVGRLVENLMGNLYKSNYTKEEFKNQYFLFNNRKQFG
KRVHSNSNGGRNDVIGPSGDAGRERMSSMQISLINNARNSIISLFNGGGRKRESDDEDDFSNLEEEANMDFTFRYPYSDL
MIWAVLTKRQKMAKLMWTHGEEGMAKALVASRLYVSLAKTASLATGEIGMSQDFTEFSDEFSELAVEVLEYCTKHGRDQT
LRLLTCELANWGDETCLSLAANNGHRKFLAHPCCQMLLSDLWQGGLLMKNNQNSKVLTCLAAPPLIFLLGFKTKEQLMLQ
PKTAAEHDEEMSDSEMNSAEDTDTSSDSSSDSDDSDEEDAKLRAQSLSADQPLSIHRLVRDKLNFSEKKKPDMGISRIVV
APPIVTGRNRARTMSIKKSKKNVIKPPACLKIETSDDDEQEQKKATEMYINRTGKRGSVAVAMNHDDMYIDPSEELDTQT
RQKSSREFSSSRNVTVQVYTQRPLSWKKKIMEFYKAPITTYWLWFFAFIWFLILLTYNLLVKTQRIASWSEWYVFAYIFV
WTLEIGRKVVSTIMMDTSKPVLKQLRVFFFQYRNGLLAFGLLTYLIAYFIRLSPTTKTLGRILIICNSVIWSLKLVDYLS
VQQGLGPYINIVAEMIPTMIPLCVLVFITLYAFGLLRQSITYPYEDWHWILVRNIFLQPYFMLYGEVYAAEIDTCGDEIW
QTHEDENIPISMLNVTHETCVPGYWIAPVGLTVFMLATNVLLMNVMVAGCTYIFEKHIQSTREIFLFERYGQVMEYESTP
WLPPPFTIIYHVIWLFKLIKSSSRMFERKNLFDQSLKLFLSPDEMEKVHTFEEESVEDMKRETEKKNLSSNDERIHRTAE
RTDAILNRVSHLTQLEFTLKEEIRELEHKMKNMDSRHKEQMNLMLDMNKKLGKFISGKYKRGSFGGSGSDGGGGSSDNSK
LEPNNSVPMITVDGPSPIGSRRTSGQYLKRDSLQAKKKITENRRSSLEQPKIPSIQFNLMEDQDESAAESATEEVSISIP
VPQMRVRQVTESDKSDLSEDDLITREDAPPTSINLPRGPRRHALYSTIADAIETEDDFYADSPVPMPMTPVQPADGSFFG
ENDSRYQRDDSDYE
Estimated Isoelectric Point:
6.96331024169922
Estimated Molecular Weight:
193.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr106
Lys110
Gln63
Leu156
Gly90
Met56
Ser141
Tyr48
His46
Glu115
Arg103
Cys20
Phe68
Pro66
Val92
Asn86
Ala95
Ile105
Trp26
Asp102