Sequence:
download
CE33610sequence.fasta
>AAGR-1 MFLKKGSTIVVLLLVFYQNTNSQSVDVSKRVDCYPEPGASQDACQSRGCIWTEAPSSSPVGTPWCYYPTESGFTVQSTGT NSFVLAAKTKNPYGNNISPLNVKYSSNGATLLLTIGNDDRYVPPVNFPKKPSTSTESLKFTSGTIGSSDVFSFKVTRAST GVALWDTSIGGMQFADKFIQIATYLPSKNIYGFGDHIHKKIRHNLDRYTTWPMFARDIGPDSGSALSTQNLYGVHPFYMC IEADGKAHGVFILNSNAQEVETGPGPHLLYRTIGGRIDMAFFPGPTPEQVVNQYLQHIGFPFLPAYWALGYQLCRWGYGN LDAMKTVISRNQALGIPLDVPYADIDYMNHYEDFTEGDNWSGFPAYTQQIHAQGLHLIVIFDPAVEVDYASFQRGINADA SFIEWARDDQVPHNIQDQYPMAKNTKIMLGNVWPDRNTAFPDFLDPRNNTNAWWAGEFAQFHKTLPFDGMWIDMNEPSNF DTGTYNTVEEQLASAKLSCPITGSDSSLDVPPYPTQAVYQRNGEYLFSKTLCMLGKTAHRTRDFYDTKNLYGWSEARATY QAIPQVTGKRSAVISRSTFPSSGRYGGHWLGDNTARWGDLQTSVIGVMEFNMFGVPYVGSDICGFNGVSNEELCLRWHQF GAFSPFSRDHNSEGMPDQDPAVWPSVANAAKIALTFRYYFLPFLYSLHYNAARYGHTVIRPLFFEFPKDEETLNISEQFL WGSALMIAPALYQGQTSVHAYFPSDTWYSLQPETYGQKMFSGFNDVNAPLSSLTPVFVRGGFVLPRQSPGTTTTASRLSP FELLITVKTNAASSGDLYYDGGDDLIPNDDIEQHPRVHWQFSFTSSIAGGVLTGNCETCSTAVRPPTLDIIEILGYPSSP NFNGFKLDGSSVTLDMTKTSYNSANQRVMISARNMISLMALKKKFTLSFTNLNVYL
view sequence (936 aa)
>AAGR-1
MFLKKGSTIVVLLLVFYQNTNSQSVDVSKRVDCYPEPGASQDACQSRGCIWTEAPSSSPVGTPWCYYPTESGFTVQSTGT
NSFVLAAKTKNPYGNNISPLNVKYSSNGATLLLTIGNDDRYVPPVNFPKKPSTSTESLKFTSGTIGSSDVFSFKVTRAST
GVALWDTSIGGMQFADKFIQIATYLPSKNIYGFGDHIHKKIRHNLDRYTTWPMFARDIGPDSGSALSTQNLYGVHPFYMC
IEADGKAHGVFILNSNAQEVETGPGPHLLYRTIGGRIDMAFFPGPTPEQVVNQYLQHIGFPFLPAYWALGYQLCRWGYGN
LDAMKTVISRNQALGIPLDVPYADIDYMNHYEDFTEGDNWSGFPAYTQQIHAQGLHLIVIFDPAVEVDYASFQRGINADA
SFIEWARDDQVPHNIQDQYPMAKNTKIMLGNVWPDRNTAFPDFLDPRNNTNAWWAGEFAQFHKTLPFDGMWIDMNEPSNF
DTGTYNTVEEQLASAKLSCPITGSDSSLDVPPYPTQAVYQRNGEYLFSKTLCMLGKTAHRTRDFYDTKNLYGWSEARATY
QAIPQVTGKRSAVISRSTFPSSGRYGGHWLGDNTARWGDLQTSVIGVMEFNMFGVPYVGSDICGFNGVSNEELCLRWHQF
GAFSPFSRDHNSEGMPDQDPAVWPSVANAAKIALTFRYYFLPFLYSLHYNAARYGHTVIRPLFFEFPKDEETLNISEQFL
WGSALMIAPALYQGQTSVHAYFPSDTWYSLQPETYGQKMFSGFNDVNAPLSSLTPVFVRGGFVLPRQSPGTTTTASRLSP
FELLITVKTNAASSGDLYYDGGDDLIPNDDIEQHPRVHWQFSFTSSIAGGVLTGNCETCSTAVRPPTLDIIEILGYPSSP
NFNGFKLDGSSVTLDMTKTSYNSANQRVMISARNMISLMALKKKFTLSFTNLNVYL
Estimated Isoelectric Point:
5.67441558837891
Estimated Molecular Weight:
104.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr69
Lys33
Gln39
Leu69
Gly73
Met21
Ser80
Tyr46
His21
Glu31
Arg35
Cys12
Phe57
Pro62
Val52
Asn53
Ala63
Ile46
Trp20
Asp54