Sequence:
download
CE33602sequence.fasta
>MPS-1 MHKNISPTCQEGIREACITLKNACDPQVLDKAAIRMREYENEFGRILYTISILIMFSFVIILLMVRSIRRTQSTVEMDSL LDAMRIREELEIQERKRRRLMRAKTQVTAWLVNKNKEKGPEKRKDSEWKPLPNGTRPRGHYSISTVTSDIPEIVVSADDC IHSDFPNRPHTPAISMIYDFGIASPDLIEPDSRKPSISSSTAIPMSSSSSSSMNSLIEPNMNSIKSNPRTYSLDTNASTS SRTPRVDCDDKSFSLDV
view sequence (257 aa)
>MPS-1
MHKNISPTCQEGIREACITLKNACDPQVLDKAAIRMREYENEFGRILYTISILIMFSFVIILLMVRSIRRTQSTVEMDSL
LDAMRIREELEIQERKRRRLMRAKTQVTAWLVNKNKEKGPEKRKDSEWKPLPNGTRPRGHYSISTVTSDIPEIVVSADDC
IHSDFPNRPHTPAISMIYDFGIASPDLIEPDSRKPSISSSTAIPMSSSSSSSMNSLIEPNMNSIKSNPRTYSLDTNASTS
SRTPRVDCDDKSFSLDV
Estimated Isoelectric Point:
8.56868743896484
Estimated Molecular Weight:
29.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys14
Gln5
Leu16
Gly6
Met11
Ser35
Tyr5
His4
Glu16
Arg22
Cys5
Phe6
Pro17
Val11
Asn12
Ala12
Ile25
Trp2
Asp17