Sequence:
download
CE33588sequence.fasta
>ANC-1, isoform a MSSSPPARPCCVCFRFRPHEDEKAQKNTFTRWINFHLEEHSSSGRIEDLFEDIRDGVLLCHLIEVLTGEALAVHKGRVSK RVHHIANLTTALTVLRRRGLELINNNAADIADGNPRIVLGLIWQIILHFQIETNMILLREWGWAATGTEEPTSSAQPEVV VTAPSPTPSSKKSHSKVSSLSGSKTSLASGEKAPSSPLRQRIASFLTPTKKAPKLTAQPVKQSVEQVFLRWINAEIGDLV GGRRVENMDKQWRDGILFCALVSRWRPDVISMREVTNANPRDNLELAFNLAHQHLGVRRLLAVEDMMIEKPDKRSVITYV SQFVRMFGERSPMQGREQHEIFLAWLEATYLLCTRHELNSQECSRIRREFIEHRPLFNTIIVTKVNYDVEELVEIEKKWD CIRETLEKYARRSERDLPEPFASIATWIAGAEHILSRPLDLDATDAKKTVTMLQKLISEHQKYMEDLPKRQEDFEEAVKH GGLGGRPVAPEFSEPLRARFAQIEEENEPRISTLRILTTHYILLQYLQHIDEKIILWRTADSVTLLLRWIKEYTQLNAEN PQAKCASYINKITLTMANDQNSKLDKEAILNTSNEKTAETLKRFESLWIELKLLKVEWVEWETHVSQLEEIIEERRRNGV PPTPEDEQALAVITAGADQLAPKLGASARLSNNQRLDVLTHSFKKLTKTTIKIGGRLVVELEPSTSEQASKISYSWQASD ELLKVEMQLRDRIQRDADSSDREQLEYRAETFRNIRDKLIELERLNEIYDNHSRDQVDTPNRNLIRHDMGTIIYGLQAGQ YANFVDLSCYAFVYDEYNQVPVNLTENVLSEDYVREIVNRKKAILTRRENNEDEIRESIRDMEECDRIIEGWQSTEIEEL RAEWNIKLSEFESWHEMMQQVEVLSQTIQTRLDVTVIQTIWILKERSYDIKHSELGGTLRESLEQLATTSETSVNRHLQN LELSNEQDCPDAIEFLEEVGRESVSKLSAAVDDRYIYTLHVLRTKMELFRRLQNFCDAVKILRSQNTKWNGIKISQIDQV QSEIDTLIVRLDEEWTQDANQLRAELASIHGSFFQLEFDRLNEKLNMLIHDKDKLRELMVHRRHYLTAANELITDSKTDL AQRATSSDHPDDILRATDEVTKALDIKGEELRRLGELAEMNITDLVVVALILSFRRRQLGSEGEPEVEELRRALREIIAR PITEPRDVSPDAIVADILRMKDEKKRDEKTIDEIQATTLTDEQRASFAPLIEDYRRRADRHRIVFEHLVMIYLDWLSRQF DELEDEIGMTIQTSRADDLRRMNSTEWNKWKTDLANIERQVGPDTKKALSAELADLHRKRDSMEARINKYLTHSAKINAK LTQFEKWLNAIEEDIEQTERQFEDPERSYRFGSLHEVALAKQRLVAKLERLNVANKEEVLRLCERYHTIMHKLTPFQTAV GLPLHVSTNLDRNGPFQSQISVSSIASSELERPESVMSLTSSIGVIPADVAELSPFEAKINKLLQKLHIIEDSYLKGPKP IDTVREDVKQLEKYRNRGAEILQQLSTSNIEDAEKEGLKHRFVLMLNNYDDILRSIENEIRDDNELTAKNQEILAELSNA EQTLQNSPLEDLDISAELDRLQMQLDLVKVMCNKPRKYVECELIDSSREGSPQERRRRKKKVMVMVSNTITTIIHVVEER LEASDISRNPDVQQKLVAVKENLRELDTTTVTPHPPSIMSPLGTENRNDLEEVKRLAAEIDRAIDTASSMYEDAPTDEDA LKSAIHLLDDQKVTLNHLHVVLEGIPEKNEQDRTDAIDIASSVGEKLGNLKSAVEEVYEEVLASTNPVKEDQPLQHIQEV QTTPAEQSNWDTDEFSRQPPVLSDERIELKTDPSAIDKFEVRSDEDPVPKIIDLFGQLQTAVNEASPLACEGTDDVDALQ VASDKLTKQDRTIRKIHAILDTIDDPVQKPAIIESLDKIKDQINNARDNINRQIDNLNYNQTPVVVPKESTKTPLNEIED AVRQASTVVSDELCNTEKLLSARQTLANVKPQVDSVEANVWSNPETIETVTPILEEYTTLVDNIEKKLANEIEVPTNDPS RQDLVQQLQDVILECEEVVVNCDNIEKLEESKLKLEKARPLLDQIGDNVEKLSREQSPDTSDAIDALSNVHQQYNATIMS IDDKIDELKNPEEDTSAADQLISELHVISEMPAVTIDLSMLNAIEEGLSTLPAHQAENVQAKIDELRQKKEVADQTEQIL SDLNAFGDMPAITLDLDLLKSVEDGIAVLPVEDSERIKAKIVDLRKKKEDADQAEALLQELSVISDMPISTLDLNMLQGI EDNLNSLPAEESDEIREKLNELRRRKQESDQAEALLQELSVISDMPISTLDLNMLQGVEDNLNSLPTEEADKIREKINDL RRRKQESDLAEALLQELSVIYDMPTSTIDLNMLQGIEDNLNSLPAEESDKIREKINDLRRRKQESDLAEALLQELSVIYD MPTSTIDLNMLQGIEDNLNSLPAEESDKIREKINDLRRRKQESDQAEALLQELSVVSDMPASTIDINMLQSIEDGLSTLL SEDRSKIQQAIDSLRKKKSDSDLAQHALEALSVQSKLPSVSINLEELKKLEETLSTVPVEDSKVIRDKIAELKTEKALAD HAENYLVELKKIEDMPISAVGSDVLATIEDQILQMPVQYQPSVKETLDKLKQAKEEDDKLAGVYDELEKIAKLPARDYDN KLLAKIDEKLNSLPKDQIAETHRKVEDIKVTKADIVAQIDVLDKLPAKDIDEHLLNSIEEKLPTIPSDSSDQLQIAIGKL RDRKQANIDEGKKILNELAEIQKMPADSLNEHALNLLATESDKFGSEISDKIMQEIDVLREKQNNHEVARLNAESVLQQL DKISEEPHLSLTEERLAPFLQNIDTVPACFVDKIRNKINEVQKLHDEAVQDEKDELKEKLVAKVQNIGKTSIDDVNVSDF EEIEREINGSLEAFEAEPLLAKIQELREAKRVGDEARSAAHDQIVALEKEAEDVTAKESAKKKKKDKKKSPQEMIDELSA KVVEAKALIPKIEEAAKNENLPADDKPKAEQLVSNLEAFVKDVETQVSEKQDELDKLNNANDAIKRLGDALDDAEKTVVP SSVPALSEFKDRIAPHLATLVEAVNDVPASVEPSAVALRDRAAKFVSDLEKNIQKTGDDEKRADELKNDVGNAVKNVEDV VSKYQNQPQPLDVAKDDANKLKATVEQLTKLAESSDKIDPQVAKDIKDSKTKAKELLQALEKAIPQEDAIRREQAEINDR LNNLEKELTKVDEFKPEDALPIVDQLAANTNTLKTATDSNNEKAVAPSSLISHDDLVVGLPEKVFQLQHAIDDKKQALNK AAAVNEIAPKLQLVSQQLQSVPQEVPASLDEQKQLLEDVENQKHNLENLLANLPENDPTADELRQKSQWDLSRLKDLLKQ LGSAVGDKLAALAAFNAARKNAEDALLDITREDGGDDNKSPDELIDDLAKKEETVAKLLDTVSGVKPDELDDKERAEYND LLARLATAADVLKNKRAELEQAVKAKADEKSLHDSVDRIVSRLVPLVRESDELRHNAEAVPTQYAPKAEELKKEVEAAKA VIANAPSSDAHVQQLEQAVATAETLIPDLEERARLWNEFLAARNDIDALIEQLQQPLDAVLAQPKRSAEEAAQDVENLRN NSQQLSDLDNKIANLQRISELLDPLESAYADVRFFDVDAEQTRHQYDDVLNDVAAELEDETLLKQSASQVANEIDDISKM IDSTDPERSILDTIAKSDIPALKAQINRIKDRIVNADASRKHVTTDPKIAEDLDNKLAKLQTELDDAIKTSDEHDKEQLI LSLKLNISQFEQIPLDQLKSDDLKTAEKEITNSLKPEEAEPLLAKIQELREAKRVGDEARSAAHDQIVALEKEAEDVTAK ESAKKKKKDKKKSPQEMIDELSAKVVEAKALIPKIEEAAKNENLPADDKPKAEQLVSNLEAFVKDVETQVSEKQDELDKL NNANDAIKRLGDALDDAEKTVVPSSVPALSEFKDRIAPHLATLVEAVNDVPASVEPSAVALRDRAAKFVSDLEKNIQKTG DDEKRADELKNDDGNAVKNVEDVVSKYQNQPQPLDVAKDDANKLKATVEQLTKLAESSDKIDPQVAKDIKDSKTKAKELL QALEKAIPQEDAIRREQAEINDRLNNLEKELTKVDEFKPEDALPIVDQLAANTNTLKTATDSNNEKAVAPSSLISHDDLV VGLPEKVFQLQHAIDDKKQALNKAAAVNEIAPKLQLVSQQLQSVPQEVPASLDEQKQLLEDVENQKHNLENLLANLPEND PTADELRQKSQWDLSRLKDLLKQLGSAVGDKLAALAAFNAARKNAEDALLDITREDGGDDNKSPDELIDDRGRSTGSAVG DKLAALAAFNAARKNAEDALLDITREDGGDDNKSPDELIDDLAKKEETVAKLLDTVSGVKPDELDDKERAEYNDLLARLA TAADVLKNKRAELEQAVKAKADEKSLHDSVDRIVSRLVPLVRESDELRHNAEAVPTQYAPKAEELKKEVEAAKAVIANAP SSDAHVQQLEQAVATAETLIPDLEERARLWNEFLAARNDIDALIEQLQQPLDAVLAQPKRSAEEAAQDVENLRNNSQQLS DLDNKIANLQRISELLDPLESAYADVRFFDVDAEQTRHQYDDVLNDVAAELEDETLLKQSASQVANEIDDISKMIDSTDP ERSILDTIAKSDIPALKAQINRIKDRIVNADASRKHVTTDPKIAEDLDNKLAKLQTELDDAIKTSDEHDKEQLILSLKLN ISQFEQIPLDQLKSDDLKTAEKEITNSLKPEEAEPLLAKIQELREAKRVGDEARSAAHDQIVALEKEAEDVTAKESAKKK KKDKKKSPQEMIDELSAKVVEAKALIPKIEEAAKNENLPADDKPKAEQLVSNLEAFVKDVETQVSEKQDELDKLNNANDA IKRLGDALDDAEKTVVPSSVPALSEFKDRIAPHLATLVEAVNDVPASVEPSAVALRDRAAKFVSDLEKNIQKTGDDEKRA DELKNDVGNAVKNVEDVVSKYQNQPQPLDVAKDDANKLKATVEQLTKLAESSDKIDPQVAKDIKDSKTKAKELLQALEKA IPQEDAIRREQAEINDRLNNLEKELTKVDEFKPEDALPIVDQLAANTNTLKTATDSNNEKAVAPSSLISHDDLVVGLPEK VFQLQHAIDDKKQALNKAAAVNEIAPKLQLVSQQLQSVPQEVPASLDEQKQLLEDVENQKHNLENLLANLPENDPTADEL RQKSQWDLSRLKDLLKQLGSAVGDKLAALAAFNAARKNAEDALLDITREDGGDDNKSPDELIDDLAKKEETVAKLLDTVS GVKPDELDDKERAEYNDLLARLATAADVLKNKRAELEQAVKAKADEKSLHDSVDRIVSRLVPLVRESDELRHNAEAVPTQ YAPKAEELKKEVEAAKAVIANAPSSDAHVQQLEQAVATAETLIPDLEERARLWNEFLAARNDIDALIEQLQQPLDAVLAQ PKRSAEEAAQDVENLRNNSQQLSDLDNKIANLQRISELLDPLESAYADVRFFDVDAEQTRHQYDDVLNDVAAELEDETLL KQSASQVANEIDDISKMIDSTDPERSILDTIAKSDIPALKAQINRIKDRIVNADASRKHVTTDPKIAEDLDNKLAKLQTE LDDAIKTSDEHDKEQLILSLKLNISQFEQIPLDQLKSDDLKTAEKEITNSLKPEEAEPLLAKIQELREAKRVGDEARSAA HDQIVALEKEAEDVTAKESAKKKKKDKKKSPQEMIDELSAKVVEAKALIPKIEEAAKNENLPADDKPKAEQLVSNLEAFV KDVETQVSEKQDELDKLNNANDAIKRLGDALDDAEKTVVPSSVPALSEFKDRIAPHLATLVEAVNDVPASVEPSAVALRD RAAKFVSDLEKNIQKTGDDEKRADELKNDVGNAVKNVEDVVSKYQNQPQPLDVAKDDANKLKATVEQLTKLAESSDKIDP QVAKDIKDSKTKAKELLQALEKAIPQEDAIRREQAEINDRLNNLEKELTKVDEFKPEDALPIVDQLAANTNTLKTATDSN NEKAVAPSSLISHDDLVVGLPEKVFQLQHAIDDKKQALNKAAAVNEIAPKLQLVSQQLQSVPQEVPASLDEQKQLLEDVE NQKHNLENLLANLPENDPTADELRQKSQWDLSRLKDLLKQLGSAVGDKLAALAAFNAARKNAEDALLDITREDGGDDNKS PDELIDDLAKKEETVAKLLDTVSGVKPDELDDKERAEYNDLLARLATAADVLKNKRAELEQAVKAKADEKSLHDSVDRIV SRLVPLVRESDELRHNAEAVPTQYAPKAEELKKEVEAAKAVIANAPSSDAHVQQLEQAVATAETLIPDLEERARLWNEFL AARNDIDALIEQLQQPLDAVLAQPKRSAEEAAQDVENLRNNSQQLSDLDNKIANLQRISELLDPLESAYADVRFFDVDAE QTRHQYDDVLNDVAAELEDETLLKQSASQVANEIDDISKMIDSTDPERSILDTIAKSDIPALKAQINRIKDRIVNADASR KHVTTDPKIAEDLDNKLAKLQTELDDAIKTSDEHDKEQLILSLKLNISQFEQIPLDQLKSDDLKTAEKEITNSLKPEEAE PLLAKIQELREAKRVGDEARSAAHDQIVALEKEAEDVTAKESAKKKKKDKKKSPQEMIDELSAKVVEAKALIPKIEEAAK NENLPADDKPKAEQLVSNLEAFVKDVETQVSEKQDELDKLNNANDAIKRLGDALDDAEKTVVPSSVPALSEFKDRIAPHL ATLVEAVNDVPASVEPSAVALRDRAAKFVSDLEKNIQKTGDDEKRADELKNDVGNAVKNVEDVVSKYQNQPQPLDVAKDD ANKLKATVEQLTKLAESSDKIDPQVAKDIKDSKTKAKELLQALEKAIPQEDAIRREQAEINDRLNNLEKELTKVDEFKPE DALPIVDQLAANTNTLKTATDSNNEKAVAPSSLISHDDLVVGLPEKVFQLQHAIDDKKQALNKAAAVNEIAPKLQLVSQQ LQSVPQEVPASLDEQKQLLEDVENQKHNLENLLANLPENDPTADELRQKSQWDLSRLKDLLKQLGSAVGDKLAALAAFNA ARKNAEDALLDITREDGGDDNKSPDELIDDLAKKEETVAKLLDTVSGVKPDELDDKERAEYNDLLARLATAADVLKNKRA ELEQAVKAKADEKSLHDSVDRIVSRLVPLVRESDELRHNAEAVPTQYAPKAEELKKEVEAAKAVIANAPSSDAHVQQLEQ AVATAETLIPDLEERARLWNEFLAARNDIDALIEQLQQPLDAVLAQPKRSAEEAAQDVENLRNNSQQLSDLDNKIANLQR ISELLDPLESAYADVRFFDVDAEQTRHQYDDVLNDVAAELEDETLLKQSASQVANEIDDISKMIDSTDPERSILDTIAKS DIPALKAQINRIKDRIVNADASRKHVTTDPKIAEDLDNKLAKLQTELDDAIKTSDEHDKEQLILSLKLNISQFEQIPLDQ LKSDDLKTAEKEITNSLKPEEAEPLLAKIQELREAKRVGDEARSAAHDQIVALEKEAEDVTAKESAKKKKKDKKKSPQEM IDELSAKVVEAKALIPKIEEAAKNENLPADDKPKAEQLVSNLEAFVKDVETQVSEKQDELDKLNNANDAIKRLGDALDDA EKTVVPSSVPALSEFKDRIAPHLATLVEAVNDVPASVEPSAVALRDRAAKFVSDLEKNIQKTGDDEKRADELKNDVGNAV KNVEDVVSKYQNQPQPLDVAKDDANKLKATVEQLTKLAESSDKIDPQVAKDIKDSKTKAKELLQALEKAIPQEDAIRREQ AEINDRLNKLEKELTKVDEFKPEDALPIVDQLAANTNTLKTATDSNNEKAVAPSSLISHDDLVVGLPEKVFQLQHAIDDK KQALNKAAAVNEIAPKLQLVSQQLQSVPQEVPASLDEQKQLLEDVENQKHNLENLLANLPENDPTADELRQKSQWDLSRL KDLLKQLGSAVGEKLAALAAFNAARKNAEDALLDITREDGGDDNKSPDELIDDLAKKEETVAKLLDTVSGVKPDELDDKE RAEYNDLLARLATAADVLKNKRAELEQAVKAKADEKSLHDSVDRIVSRLVPLVRESDELRHNAEAVPTQYAPKAEELKKE VEAAKAVIANAPSSDAHVQQLEQAVATAETLIPDLEERASIWERFVKAKDDLYDYLEKLENNVSDVLNRPRLPVSQAQQR FNKLKEQSYLLDRIRDLKIDFDDLGEALLPLTVAEDELRFMHVHVESIERQYEDTMDKLNAEITAEVELLRTLDILSNEL SQCKEDINNPSVDVDELSRATMLNDAIAHLENQKVVVARSEKDRKFVESSTSIDLDQLLAEAKRLLKEIEPRLQLAQPDH DNEDDEDEEKGSDEKPYDVRAAAEVLSALYPDEHPHNVLRNIGFEELPSDSESRSEFDSLDSRSDGLLSPIPDDSTLSEE QLRRQRSRWRRVLRTALPLQALLVLLMGAACLVPHCDDEYCCQLLNNFAKSFDPSLEFVNGPPPF
view sequence (8545 aa)
>ANC-1, isoform a
MSSSPPARPCCVCFRFRPHEDEKAQKNTFTRWINFHLEEHSSSGRIEDLFEDIRDGVLLCHLIEVLTGEALAVHKGRVSK
RVHHIANLTTALTVLRRRGLELINNNAADIADGNPRIVLGLIWQIILHFQIETNMILLREWGWAATGTEEPTSSAQPEVV
VTAPSPTPSSKKSHSKVSSLSGSKTSLASGEKAPSSPLRQRIASFLTPTKKAPKLTAQPVKQSVEQVFLRWINAEIGDLV
GGRRVENMDKQWRDGILFCALVSRWRPDVISMREVTNANPRDNLELAFNLAHQHLGVRRLLAVEDMMIEKPDKRSVITYV
SQFVRMFGERSPMQGREQHEIFLAWLEATYLLCTRHELNSQECSRIRREFIEHRPLFNTIIVTKVNYDVEELVEIEKKWD
CIRETLEKYARRSERDLPEPFASIATWIAGAEHILSRPLDLDATDAKKTVTMLQKLISEHQKYMEDLPKRQEDFEEAVKH
GGLGGRPVAPEFSEPLRARFAQIEEENEPRISTLRILTTHYILLQYLQHIDEKIILWRTADSVTLLLRWIKEYTQLNAEN
PQAKCASYINKITLTMANDQNSKLDKEAILNTSNEKTAETLKRFESLWIELKLLKVEWVEWETHVSQLEEIIEERRRNGV
PPTPEDEQALAVITAGADQLAPKLGASARLSNNQRLDVLTHSFKKLTKTTIKIGGRLVVELEPSTSEQASKISYSWQASD
ELLKVEMQLRDRIQRDADSSDREQLEYRAETFRNIRDKLIELERLNEIYDNHSRDQVDTPNRNLIRHDMGTIIYGLQAGQ
YANFVDLSCYAFVYDEYNQVPVNLTENVLSEDYVREIVNRKKAILTRRENNEDEIRESIRDMEECDRIIEGWQSTEIEEL
RAEWNIKLSEFESWHEMMQQVEVLSQTIQTRLDVTVIQTIWILKERSYDIKHSELGGTLRESLEQLATTSETSVNRHLQN
LELSNEQDCPDAIEFLEEVGRESVSKLSAAVDDRYIYTLHVLRTKMELFRRLQNFCDAVKILRSQNTKWNGIKISQIDQV
QSEIDTLIVRLDEEWTQDANQLRAELASIHGSFFQLEFDRLNEKLNMLIHDKDKLRELMVHRRHYLTAANELITDSKTDL
AQRATSSDHPDDILRATDEVTKALDIKGEELRRLGELAEMNITDLVVVALILSFRRRQLGSEGEPEVEELRRALREIIAR
PITEPRDVSPDAIVADILRMKDEKKRDEKTIDEIQATTLTDEQRASFAPLIEDYRRRADRHRIVFEHLVMIYLDWLSRQF
DELEDEIGMTIQTSRADDLRRMNSTEWNKWKTDLANIERQVGPDTKKALSAELADLHRKRDSMEARINKYLTHSAKINAK
LTQFEKWLNAIEEDIEQTERQFEDPERSYRFGSLHEVALAKQRLVAKLERLNVANKEEVLRLCERYHTIMHKLTPFQTAV
GLPLHVSTNLDRNGPFQSQISVSSIASSELERPESVMSLTSSIGVIPADVAELSPFEAKINKLLQKLHIIEDSYLKGPKP
IDTVREDVKQLEKYRNRGAEILQQLSTSNIEDAEKEGLKHRFVLMLNNYDDILRSIENEIRDDNELTAKNQEILAELSNA
EQTLQNSPLEDLDISAELDRLQMQLDLVKVMCNKPRKYVECELIDSSREGSPQERRRRKKKVMVMVSNTITTIIHVVEER
LEASDISRNPDVQQKLVAVKENLRELDTTTVTPHPPSIMSPLGTENRNDLEEVKRLAAEIDRAIDTASSMYEDAPTDEDA
LKSAIHLLDDQKVTLNHLHVVLEGIPEKNEQDRTDAIDIASSVGEKLGNLKSAVEEVYEEVLASTNPVKEDQPLQHIQEV
QTTPAEQSNWDTDEFSRQPPVLSDERIELKTDPSAIDKFEVRSDEDPVPKIIDLFGQLQTAVNEASPLACEGTDDVDALQ
VASDKLTKQDRTIRKIHAILDTIDDPVQKPAIIESLDKIKDQINNARDNINRQIDNLNYNQTPVVVPKESTKTPLNEIED
AVRQASTVVSDELCNTEKLLSARQTLANVKPQVDSVEANVWSNPETIETVTPILEEYTTLVDNIEKKLANEIEVPTNDPS
RQDLVQQLQDVILECEEVVVNCDNIEKLEESKLKLEKARPLLDQIGDNVEKLSREQSPDTSDAIDALSNVHQQYNATIMS
IDDKIDELKNPEEDTSAADQLISELHVISEMPAVTIDLSMLNAIEEGLSTLPAHQAENVQAKIDELRQKKEVADQTEQIL
SDLNAFGDMPAITLDLDLLKSVEDGIAVLPVEDSERIKAKIVDLRKKKEDADQAEALLQELSVISDMPISTLDLNMLQGI
EDNLNSLPAEESDEIREKLNELRRRKQESDQAEALLQELSVISDMPISTLDLNMLQGVEDNLNSLPTEEADKIREKINDL
RRRKQESDLAEALLQELSVIYDMPTSTIDLNMLQGIEDNLNSLPAEESDKIREKINDLRRRKQESDLAEALLQELSVIYD
MPTSTIDLNMLQGIEDNLNSLPAEESDKIREKINDLRRRKQESDQAEALLQELSVVSDMPASTIDINMLQSIEDGLSTLL
SEDRSKIQQAIDSLRKKKSDSDLAQHALEALSVQSKLPSVSINLEELKKLEETLSTVPVEDSKVIRDKIAELKTEKALAD
HAENYLVELKKIEDMPISAVGSDVLATIEDQILQMPVQYQPSVKETLDKLKQAKEEDDKLAGVYDELEKIAKLPARDYDN
KLLAKIDEKLNSLPKDQIAETHRKVEDIKVTKADIVAQIDVLDKLPAKDIDEHLLNSIEEKLPTIPSDSSDQLQIAIGKL
RDRKQANIDEGKKILNELAEIQKMPADSLNEHALNLLATESDKFGSEISDKIMQEIDVLREKQNNHEVARLNAESVLQQL
DKISEEPHLSLTEERLAPFLQNIDTVPACFVDKIRNKINEVQKLHDEAVQDEKDELKEKLVAKVQNIGKTSIDDVNVSDF
EEIEREINGSLEAFEAEPLLAKIQELREAKRVGDEARSAAHDQIVALEKEAEDVTAKESAKKKKKDKKKSPQEMIDELSA
KVVEAKALIPKIEEAAKNENLPADDKPKAEQLVSNLEAFVKDVETQVSEKQDELDKLNNANDAIKRLGDALDDAEKTVVP
SSVPALSEFKDRIAPHLATLVEAVNDVPASVEPSAVALRDRAAKFVSDLEKNIQKTGDDEKRADELKNDVGNAVKNVEDV
VSKYQNQPQPLDVAKDDANKLKATVEQLTKLAESSDKIDPQVAKDIKDSKTKAKELLQALEKAIPQEDAIRREQAEINDR
LNNLEKELTKVDEFKPEDALPIVDQLAANTNTLKTATDSNNEKAVAPSSLISHDDLVVGLPEKVFQLQHAIDDKKQALNK
AAAVNEIAPKLQLVSQQLQSVPQEVPASLDEQKQLLEDVENQKHNLENLLANLPENDPTADELRQKSQWDLSRLKDLLKQ
LGSAVGDKLAALAAFNAARKNAEDALLDITREDGGDDNKSPDELIDDLAKKEETVAKLLDTVSGVKPDELDDKERAEYND
LLARLATAADVLKNKRAELEQAVKAKADEKSLHDSVDRIVSRLVPLVRESDELRHNAEAVPTQYAPKAEELKKEVEAAKA
VIANAPSSDAHVQQLEQAVATAETLIPDLEERARLWNEFLAARNDIDALIEQLQQPLDAVLAQPKRSAEEAAQDVENLRN
NSQQLSDLDNKIANLQRISELLDPLESAYADVRFFDVDAEQTRHQYDDVLNDVAAELEDETLLKQSASQVANEIDDISKM
IDSTDPERSILDTIAKSDIPALKAQINRIKDRIVNADASRKHVTTDPKIAEDLDNKLAKLQTELDDAIKTSDEHDKEQLI
LSLKLNISQFEQIPLDQLKSDDLKTAEKEITNSLKPEEAEPLLAKIQELREAKRVGDEARSAAHDQIVALEKEAEDVTAK
ESAKKKKKDKKKSPQEMIDELSAKVVEAKALIPKIEEAAKNENLPADDKPKAEQLVSNLEAFVKDVETQVSEKQDELDKL
NNANDAIKRLGDALDDAEKTVVPSSVPALSEFKDRIAPHLATLVEAVNDVPASVEPSAVALRDRAAKFVSDLEKNIQKTG
DDEKRADELKNDDGNAVKNVEDVVSKYQNQPQPLDVAKDDANKLKATVEQLTKLAESSDKIDPQVAKDIKDSKTKAKELL
QALEKAIPQEDAIRREQAEINDRLNNLEKELTKVDEFKPEDALPIVDQLAANTNTLKTATDSNNEKAVAPSSLISHDDLV
VGLPEKVFQLQHAIDDKKQALNKAAAVNEIAPKLQLVSQQLQSVPQEVPASLDEQKQLLEDVENQKHNLENLLANLPEND
PTADELRQKSQWDLSRLKDLLKQLGSAVGDKLAALAAFNAARKNAEDALLDITREDGGDDNKSPDELIDDRGRSTGSAVG
DKLAALAAFNAARKNAEDALLDITREDGGDDNKSPDELIDDLAKKEETVAKLLDTVSGVKPDELDDKERAEYNDLLARLA
TAADVLKNKRAELEQAVKAKADEKSLHDSVDRIVSRLVPLVRESDELRHNAEAVPTQYAPKAEELKKEVEAAKAVIANAP
SSDAHVQQLEQAVATAETLIPDLEERARLWNEFLAARNDIDALIEQLQQPLDAVLAQPKRSAEEAAQDVENLRNNSQQLS
DLDNKIANLQRISELLDPLESAYADVRFFDVDAEQTRHQYDDVLNDVAAELEDETLLKQSASQVANEIDDISKMIDSTDP
ERSILDTIAKSDIPALKAQINRIKDRIVNADASRKHVTTDPKIAEDLDNKLAKLQTELDDAIKTSDEHDKEQLILSLKLN
ISQFEQIPLDQLKSDDLKTAEKEITNSLKPEEAEPLLAKIQELREAKRVGDEARSAAHDQIVALEKEAEDVTAKESAKKK
KKDKKKSPQEMIDELSAKVVEAKALIPKIEEAAKNENLPADDKPKAEQLVSNLEAFVKDVETQVSEKQDELDKLNNANDA
IKRLGDALDDAEKTVVPSSVPALSEFKDRIAPHLATLVEAVNDVPASVEPSAVALRDRAAKFVSDLEKNIQKTGDDEKRA
DELKNDVGNAVKNVEDVVSKYQNQPQPLDVAKDDANKLKATVEQLTKLAESSDKIDPQVAKDIKDSKTKAKELLQALEKA
IPQEDAIRREQAEINDRLNNLEKELTKVDEFKPEDALPIVDQLAANTNTLKTATDSNNEKAVAPSSLISHDDLVVGLPEK
VFQLQHAIDDKKQALNKAAAVNEIAPKLQLVSQQLQSVPQEVPASLDEQKQLLEDVENQKHNLENLLANLPENDPTADEL
RQKSQWDLSRLKDLLKQLGSAVGDKLAALAAFNAARKNAEDALLDITREDGGDDNKSPDELIDDLAKKEETVAKLLDTVS
GVKPDELDDKERAEYNDLLARLATAADVLKNKRAELEQAVKAKADEKSLHDSVDRIVSRLVPLVRESDELRHNAEAVPTQ
YAPKAEELKKEVEAAKAVIANAPSSDAHVQQLEQAVATAETLIPDLEERARLWNEFLAARNDIDALIEQLQQPLDAVLAQ
PKRSAEEAAQDVENLRNNSQQLSDLDNKIANLQRISELLDPLESAYADVRFFDVDAEQTRHQYDDVLNDVAAELEDETLL
KQSASQVANEIDDISKMIDSTDPERSILDTIAKSDIPALKAQINRIKDRIVNADASRKHVTTDPKIAEDLDNKLAKLQTE
LDDAIKTSDEHDKEQLILSLKLNISQFEQIPLDQLKSDDLKTAEKEITNSLKPEEAEPLLAKIQELREAKRVGDEARSAA
HDQIVALEKEAEDVTAKESAKKKKKDKKKSPQEMIDELSAKVVEAKALIPKIEEAAKNENLPADDKPKAEQLVSNLEAFV
KDVETQVSEKQDELDKLNNANDAIKRLGDALDDAEKTVVPSSVPALSEFKDRIAPHLATLVEAVNDVPASVEPSAVALRD
RAAKFVSDLEKNIQKTGDDEKRADELKNDVGNAVKNVEDVVSKYQNQPQPLDVAKDDANKLKATVEQLTKLAESSDKIDP
QVAKDIKDSKTKAKELLQALEKAIPQEDAIRREQAEINDRLNNLEKELTKVDEFKPEDALPIVDQLAANTNTLKTATDSN
NEKAVAPSSLISHDDLVVGLPEKVFQLQHAIDDKKQALNKAAAVNEIAPKLQLVSQQLQSVPQEVPASLDEQKQLLEDVE
NQKHNLENLLANLPENDPTADELRQKSQWDLSRLKDLLKQLGSAVGDKLAALAAFNAARKNAEDALLDITREDGGDDNKS
PDELIDDLAKKEETVAKLLDTVSGVKPDELDDKERAEYNDLLARLATAADVLKNKRAELEQAVKAKADEKSLHDSVDRIV
SRLVPLVRESDELRHNAEAVPTQYAPKAEELKKEVEAAKAVIANAPSSDAHVQQLEQAVATAETLIPDLEERARLWNEFL
AARNDIDALIEQLQQPLDAVLAQPKRSAEEAAQDVENLRNNSQQLSDLDNKIANLQRISELLDPLESAYADVRFFDVDAE
QTRHQYDDVLNDVAAELEDETLLKQSASQVANEIDDISKMIDSTDPERSILDTIAKSDIPALKAQINRIKDRIVNADASR
KHVTTDPKIAEDLDNKLAKLQTELDDAIKTSDEHDKEQLILSLKLNISQFEQIPLDQLKSDDLKTAEKEITNSLKPEEAE
PLLAKIQELREAKRVGDEARSAAHDQIVALEKEAEDVTAKESAKKKKKDKKKSPQEMIDELSAKVVEAKALIPKIEEAAK
NENLPADDKPKAEQLVSNLEAFVKDVETQVSEKQDELDKLNNANDAIKRLGDALDDAEKTVVPSSVPALSEFKDRIAPHL
ATLVEAVNDVPASVEPSAVALRDRAAKFVSDLEKNIQKTGDDEKRADELKNDVGNAVKNVEDVVSKYQNQPQPLDVAKDD
ANKLKATVEQLTKLAESSDKIDPQVAKDIKDSKTKAKELLQALEKAIPQEDAIRREQAEINDRLNNLEKELTKVDEFKPE
DALPIVDQLAANTNTLKTATDSNNEKAVAPSSLISHDDLVVGLPEKVFQLQHAIDDKKQALNKAAAVNEIAPKLQLVSQQ
LQSVPQEVPASLDEQKQLLEDVENQKHNLENLLANLPENDPTADELRQKSQWDLSRLKDLLKQLGSAVGDKLAALAAFNA
ARKNAEDALLDITREDGGDDNKSPDELIDDLAKKEETVAKLLDTVSGVKPDELDDKERAEYNDLLARLATAADVLKNKRA
ELEQAVKAKADEKSLHDSVDRIVSRLVPLVRESDELRHNAEAVPTQYAPKAEELKKEVEAAKAVIANAPSSDAHVQQLEQ
AVATAETLIPDLEERARLWNEFLAARNDIDALIEQLQQPLDAVLAQPKRSAEEAAQDVENLRNNSQQLSDLDNKIANLQR
ISELLDPLESAYADVRFFDVDAEQTRHQYDDVLNDVAAELEDETLLKQSASQVANEIDDISKMIDSTDPERSILDTIAKS
DIPALKAQINRIKDRIVNADASRKHVTTDPKIAEDLDNKLAKLQTELDDAIKTSDEHDKEQLILSLKLNISQFEQIPLDQ
LKSDDLKTAEKEITNSLKPEEAEPLLAKIQELREAKRVGDEARSAAHDQIVALEKEAEDVTAKESAKKKKKDKKKSPQEM
IDELSAKVVEAKALIPKIEEAAKNENLPADDKPKAEQLVSNLEAFVKDVETQVSEKQDELDKLNNANDAIKRLGDALDDA
EKTVVPSSVPALSEFKDRIAPHLATLVEAVNDVPASVEPSAVALRDRAAKFVSDLEKNIQKTGDDEKRADELKNDVGNAV
KNVEDVVSKYQNQPQPLDVAKDDANKLKATVEQLTKLAESSDKIDPQVAKDIKDSKTKAKELLQALEKAIPQEDAIRREQ
AEINDRLNKLEKELTKVDEFKPEDALPIVDQLAANTNTLKTATDSNNEKAVAPSSLISHDDLVVGLPEKVFQLQHAIDDK
KQALNKAAAVNEIAPKLQLVSQQLQSVPQEVPASLDEQKQLLEDVENQKHNLENLLANLPENDPTADELRQKSQWDLSRL
KDLLKQLGSAVGEKLAALAAFNAARKNAEDALLDITREDGGDDNKSPDELIDDLAKKEETVAKLLDTVSGVKPDELDDKE
RAEYNDLLARLATAADVLKNKRAELEQAVKAKADEKSLHDSVDRIVSRLVPLVRESDELRHNAEAVPTQYAPKAEELKKE
VEAAKAVIANAPSSDAHVQQLEQAVATAETLIPDLEERASIWERFVKAKDDLYDYLEKLENNVSDVLNRPRLPVSQAQQR
FNKLKEQSYLLDRIRDLKIDFDDLGEALLPLTVAEDELRFMHVHVESIERQYEDTMDKLNAEITAEVELLRTLDILSNEL
SQCKEDINNPSVDVDELSRATMLNDAIAHLENQKVVVARSEKDRKFVESSTSIDLDQLLAEAKRLLKEIEPRLQLAQPDH
DNEDDEDEEKGSDEKPYDVRAAAEVLSALYPDEHPHNVLRNIGFEELPSDSESRSEFDSLDSRSDGLLSPIPDDSTLSEE
QLRRQRSRWRRVLRTALPLQALLVLLMGAACLVPHCDDEYCCQLLNNFAKSFDPSLEFVNGPPPF
Estimated Isoelectric Point:
4.72283172607422
Estimated Molecular Weight:
956.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr342
Lys745
Gln466
Leu998
Gly144
Met67
Ser529
Tyr77
His130
Glu898
Arg411
Cys26
Phe119
Pro351
Val554
Asn435
Ala909
Ile462
Trp41
Asp841